BLASTX nr result
ID: Akebia24_contig00018100
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00018100 (365 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006398873.1| hypothetical protein EUTSA_v10013932mg [Eutr... 64 2e-08 ref|XP_006351292.1| PREDICTED: probable calcium-binding protein ... 64 3e-08 ref|XP_004249218.1| PREDICTED: probable calcium-binding protein ... 64 3e-08 ref|XP_004978627.1| PREDICTED: probable calcium-binding protein ... 63 4e-08 gb|AFW64764.1| grancalcin [Zea mays] 63 4e-08 gb|AFW64763.1| hypothetical protein ZEAMMB73_778929 [Zea mays] 63 4e-08 ref|XP_002450240.1| hypothetical protein SORBIDRAFT_05g002410 [S... 63 4e-08 gb|ACN31166.1| unknown [Zea mays] 63 4e-08 ref|XP_002534120.1| ef-hand calcium binding protein, putative [R... 63 4e-08 ref|NP_001147282.1| grancalcin [Zea mays] gi|195609464|gb|ACG265... 63 4e-08 gb|EPS62532.1| hypothetical protein M569_12259 [Genlisea aurea] 62 6e-08 ref|XP_003578961.1| PREDICTED: probable calcium-binding protein ... 62 6e-08 ref|XP_006664974.1| PREDICTED: probable calcium-binding protein ... 62 1e-07 ref|XP_004142653.1| PREDICTED: probable calcium-binding protein ... 62 1e-07 ref|NP_001066106.1| Os12g0137100 [Oryza sativa Japonica Group] g... 62 1e-07 ref|NP_001065711.1| Os11g0140600 [Oryza sativa Japonica Group] g... 62 1e-07 emb|CBX24414.1| hypothetical_protein [Oryza glaberrima] 62 1e-07 emb|CBX25361.1| hypothetical_protein [Oryza brachyantha] 62 1e-07 ref|XP_002871078.1| hypothetical protein ARALYDRAFT_908301 [Arab... 62 1e-07 gb|EEE52738.1| hypothetical protein OsJ_35159 [Oryza sativa Japo... 62 1e-07 >ref|XP_006398873.1| hypothetical protein EUTSA_v10013932mg [Eutrema salsugineum] gi|557099963|gb|ESQ40326.1| hypothetical protein EUTSA_v10013932mg [Eutrema salsugineum] Length = 358 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -1 Query: 365 TEKFKEKDTMYSGSATFTYETFMLTVLPFLIA 270 TEKFKEKDT YSGSATFTYETFMLTVLPFLIA Sbjct: 327 TEKFKEKDTGYSGSATFTYETFMLTVLPFLIA 358 >ref|XP_006351292.1| PREDICTED: probable calcium-binding protein CML49-like [Solanum tuberosum] Length = 344 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -1 Query: 365 TEKFKEKDTMYSGSATFTYETFMLTVLPFLIA 270 TEKFKEKDT YSGSATFTYE+FMLTVLPFLIA Sbjct: 313 TEKFKEKDTSYSGSATFTYESFMLTVLPFLIA 344 >ref|XP_004249218.1| PREDICTED: probable calcium-binding protein CML49-like [Solanum lycopersicum] Length = 340 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -1 Query: 365 TEKFKEKDTMYSGSATFTYETFMLTVLPFLIA 270 TEKFKEKDT YSGSATFTYE+FMLTVLPFLIA Sbjct: 309 TEKFKEKDTSYSGSATFTYESFMLTVLPFLIA 340 >ref|XP_004978627.1| PREDICTED: probable calcium-binding protein CML50-like [Setaria italica] Length = 307 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = -1 Query: 365 TEKFKEKDTMYSGSATFTYETFMLTVLPFLIA 270 TEKFKEKDT YSGSATFTYE FMLTVLPFLIA Sbjct: 276 TEKFKEKDTAYSGSATFTYEAFMLTVLPFLIA 307 >gb|AFW64764.1| grancalcin [Zea mays] Length = 296 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = -1 Query: 365 TEKFKEKDTMYSGSATFTYETFMLTVLPFLIA 270 TEKFKEKDT YSGSATFTYE FMLTVLPFLIA Sbjct: 265 TEKFKEKDTAYSGSATFTYEAFMLTVLPFLIA 296 >gb|AFW64763.1| hypothetical protein ZEAMMB73_778929 [Zea mays] Length = 84 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = -1 Query: 365 TEKFKEKDTMYSGSATFTYETFMLTVLPFLIA 270 TEKFKEKDT YSGSATFTYE FMLTVLPFLIA Sbjct: 53 TEKFKEKDTAYSGSATFTYEAFMLTVLPFLIA 84 >ref|XP_002450240.1| hypothetical protein SORBIDRAFT_05g002410 [Sorghum bicolor] gi|241936083|gb|EES09228.1| hypothetical protein SORBIDRAFT_05g002410 [Sorghum bicolor] Length = 304 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = -1 Query: 365 TEKFKEKDTMYSGSATFTYETFMLTVLPFLIA 270 TEKFKEKDT YSGSATFTYE FMLTVLPFLIA Sbjct: 273 TEKFKEKDTAYSGSATFTYEAFMLTVLPFLIA 304 >gb|ACN31166.1| unknown [Zea mays] Length = 153 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = -1 Query: 365 TEKFKEKDTMYSGSATFTYETFMLTVLPFLIA 270 TEKFKEKDT YSGSATFTYE FMLTVLPFLIA Sbjct: 122 TEKFKEKDTAYSGSATFTYEAFMLTVLPFLIA 153 >ref|XP_002534120.1| ef-hand calcium binding protein, putative [Ricinus communis] gi|223525823|gb|EEF28264.1| ef-hand calcium binding protein, putative [Ricinus communis] Length = 266 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = -1 Query: 365 TEKFKEKDTMYSGSATFTYETFMLTVLPFLIA 270 TEKFKEKDT YSGSATFTYE FMLTVLPFLIA Sbjct: 235 TEKFKEKDTSYSGSATFTYEAFMLTVLPFLIA 266 >ref|NP_001147282.1| grancalcin [Zea mays] gi|195609464|gb|ACG26562.1| grancalcin [Zea mays] Length = 301 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = -1 Query: 365 TEKFKEKDTMYSGSATFTYETFMLTVLPFLIA 270 TEKFKEKDT YSGSATFTYE FMLTVLPFLIA Sbjct: 270 TEKFKEKDTAYSGSATFTYEAFMLTVLPFLIA 301 >gb|EPS62532.1| hypothetical protein M569_12259 [Genlisea aurea] Length = 278 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 365 TEKFKEKDTMYSGSATFTYETFMLTVLPFLIA 270 TEKFKE+DT +SGSATFTYETFMLTVLPFLIA Sbjct: 247 TEKFKERDTSFSGSATFTYETFMLTVLPFLIA 278 >ref|XP_003578961.1| PREDICTED: probable calcium-binding protein CML49-like isoform 1 [Brachypodium distachyon] gi|357161050|ref|XP_003578962.1| PREDICTED: probable calcium-binding protein CML49-like isoform 2 [Brachypodium distachyon] Length = 327 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -1 Query: 365 TEKFKEKDTMYSGSATFTYETFMLTVLPFLIA 270 TEKFKEKDT YSGSATFTYE FMLTVLPF+IA Sbjct: 296 TEKFKEKDTAYSGSATFTYEAFMLTVLPFIIA 327 >ref|XP_006664974.1| PREDICTED: probable calcium-binding protein CML49-like [Oryza brachyantha] Length = 221 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -1 Query: 365 TEKFKEKDTMYSGSATFTYETFMLTVLPFLIA 270 TEKFKEKDT +SGSATFTYE FMLTVLPFLIA Sbjct: 190 TEKFKEKDTAFSGSATFTYEAFMLTVLPFLIA 221 >ref|XP_004142653.1| PREDICTED: probable calcium-binding protein CML49-like [Cucumis sativus] Length = 290 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -1 Query: 365 TEKFKEKDTMYSGSATFTYETFMLTVLPFLIA 270 TEKFKEKDT YSGSATF+YE FMLTVLPFLIA Sbjct: 259 TEKFKEKDTTYSGSATFSYEAFMLTVLPFLIA 290 >ref|NP_001066106.1| Os12g0137100 [Oryza sativa Japonica Group] gi|77552964|gb|ABA95760.1| EF hand family protein, expressed [Oryza sativa Japonica Group] gi|113648613|dbj|BAF29125.1| Os12g0137100 [Oryza sativa Japonica Group] gi|125535715|gb|EAY82203.1| hypothetical protein OsI_37406 [Oryza sativa Indica Group] gi|215765243|dbj|BAG86940.1| unnamed protein product [Oryza sativa Japonica Group] Length = 292 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -1 Query: 365 TEKFKEKDTMYSGSATFTYETFMLTVLPFLIA 270 TEKFKEKDT +SGSATFTYE FMLTVLPFLIA Sbjct: 261 TEKFKEKDTAFSGSATFTYEAFMLTVLPFLIA 292 >ref|NP_001065711.1| Os11g0140600 [Oryza sativa Japonica Group] gi|77548608|gb|ABA91405.1| EF hand family protein, expressed [Oryza sativa Japonica Group] gi|113644415|dbj|BAF27556.1| Os11g0140600 [Oryza sativa Japonica Group] gi|215737137|dbj|BAG96066.1| unnamed protein product [Oryza sativa Japonica Group] Length = 308 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -1 Query: 365 TEKFKEKDTMYSGSATFTYETFMLTVLPFLIA 270 TEKFKEKDT +SGSATFTYE FMLTVLPFLIA Sbjct: 277 TEKFKEKDTAFSGSATFTYEAFMLTVLPFLIA 308 >emb|CBX24414.1| hypothetical_protein [Oryza glaberrima] Length = 286 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -1 Query: 365 TEKFKEKDTMYSGSATFTYETFMLTVLPFLIA 270 TEKFKEKDT +SGSATFTYE FMLTVLPFLIA Sbjct: 255 TEKFKEKDTAFSGSATFTYEAFMLTVLPFLIA 286 >emb|CBX25361.1| hypothetical_protein [Oryza brachyantha] Length = 302 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -1 Query: 365 TEKFKEKDTMYSGSATFTYETFMLTVLPFLIA 270 TEKFKEKDT +SGSATFTYE FMLTVLPFLIA Sbjct: 271 TEKFKEKDTAFSGSATFTYEAFMLTVLPFLIA 302 >ref|XP_002871078.1| hypothetical protein ARALYDRAFT_908301 [Arabidopsis lyrata subsp. lyrata] gi|297316915|gb|EFH47337.1| hypothetical protein ARALYDRAFT_908301 [Arabidopsis lyrata subsp. lyrata] Length = 362 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -1 Query: 365 TEKFKEKDTMYSGSATFTYETFMLTVLPFLIA 270 TEKFKEKDT YSGSATF YE+FMLTVLPFLIA Sbjct: 331 TEKFKEKDTAYSGSATFNYESFMLTVLPFLIA 362 >gb|EEE52738.1| hypothetical protein OsJ_35159 [Oryza sativa Japonica Group] Length = 263 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -1 Query: 365 TEKFKEKDTMYSGSATFTYETFMLTVLPFLIA 270 TEKFKEKDT +SGSATFTYE FMLTVLPFLIA Sbjct: 232 TEKFKEKDTAFSGSATFTYEAFMLTVLPFLIA 263