BLASTX nr result
ID: Akebia24_contig00017668
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00017668 (354 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006408604.1| hypothetical protein EUTSA_v10002214mg, part... 39 1e-06 ref|XP_006409464.1| hypothetical protein EUTSA_v10023107mg, part... 41 5e-06 >ref|XP_006408604.1| hypothetical protein EUTSA_v10002214mg, partial [Eutrema salsugineum] gi|557109760|gb|ESQ50057.1| hypothetical protein EUTSA_v10002214mg, partial [Eutrema salsugineum] Length = 233 Score = 38.9 bits (89), Expect(2) = 1e-06 Identities = 21/47 (44%), Positives = 28/47 (59%) Frame = +2 Query: 2 ALKLYFAGTLVIRLRMLMLKFDSYKKACNDNVVEHLRKISQIIRNLK 142 ALK F T +LR L K + YKK N ++ +HLR +S +IR LK Sbjct: 58 ALKDKFGATSATKLRRLNQKLNDYKKRPNQSMRQHLRIMSNMIRELK 104 Score = 38.9 bits (89), Expect(2) = 1e-06 Identities = 20/51 (39%), Positives = 29/51 (56%) Frame = +3 Query: 159 LTGEQ*ICVGLRPLLDF*EHMKFNMTHNGSITKFSQLSRHLGLKLEHQSVS 311 ++ EQ + LR L + +HMK MTHN ++ F +SRHL L+ E S Sbjct: 110 MSNEQQVQAVLRSLPESWDHMKIQMTHNENVKTFEDISRHLELEDERIEAS 160 >ref|XP_006409464.1| hypothetical protein EUTSA_v10023107mg, partial [Eutrema salsugineum] gi|557110626|gb|ESQ50917.1| hypothetical protein EUTSA_v10023107mg, partial [Eutrema salsugineum] Length = 278 Score = 41.2 bits (95), Expect(2) = 5e-06 Identities = 22/47 (46%), Positives = 29/47 (61%) Frame = +2 Query: 2 ALKLYFAGTLVIRLRMLMLKFDSYKKACNDNVVEHLRKISQIIRNLK 142 ALK F T +LR L KF+ YKK N ++ +HLR +S +IR LK Sbjct: 103 ALKDKFGATSATKLRRLNQKFNDYKKRPNQSMRQHLRIMSNMIRELK 149 Score = 34.7 bits (78), Expect(2) = 5e-06 Identities = 19/51 (37%), Positives = 27/51 (52%) Frame = +3 Query: 159 LTGEQ*ICVGLRPLLDF*EHMKFNMTHNGSITKFSQLSRHLGLKLEHQSVS 311 ++ EQ + LR L + +HMK MTHN + F +S HL L+ E S Sbjct: 155 MSNEQQVQAVLRSLPESWDHMKVQMTHNENEKTFEDISHHLELEDERLEAS 205