BLASTX nr result
ID: Akebia24_contig00017660
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00017660 (252 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006859070.1| hypothetical protein AMTR_s00068p00200420 [A... 66 6e-09 >ref|XP_006859070.1| hypothetical protein AMTR_s00068p00200420 [Amborella trichopoda] gi|548863182|gb|ERN20537.1| hypothetical protein AMTR_s00068p00200420 [Amborella trichopoda] Length = 380 Score = 65.9 bits (159), Expect = 6e-09 Identities = 37/75 (49%), Positives = 45/75 (60%), Gaps = 3/75 (4%) Frame = +1 Query: 16 NQNREXXXXXXXXXNRGGDVLLQWGQNKRSRGSRAENRVMVMTDDQSAVQSRQVIKIQRR 195 N N N GGD++LQWGQNKRSRG R+ENRV+ D+S+ Q+RQ +KI RR Sbjct: 94 NNNNNVGKTHALENNMGGDIILQWGQNKRSRGFRSENRVL---GDESSTQARQAVKIPRR 150 Query: 196 V---EKQQQGIMKQT 231 V EK Q QT Sbjct: 151 VVGPEKLQSHGAHQT 165