BLASTX nr result
ID: Akebia24_contig00017629
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00017629 (207 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABG81098.1| thioredoxin H [Pelargonium x hortorum] 62 1e-07 gb|EXB30121.1| Thioredoxin H2-2 [Morus notabilis] 61 1e-07 ref|XP_006482526.1| PREDICTED: thioredoxin H2-like [Citrus sinen... 61 1e-07 ref|XP_003552507.1| PREDICTED: thioredoxin H2 [Glycine max] 61 2e-07 gb|AAQ23133.1| thioredoxin H2 [Ipomoea batatas] 61 2e-07 gb|AGG19195.1| thioredoxin H-type 4, partial [Tamarix hispida] 60 2e-07 ref|NP_001237440.1| thioredoxin [Glycine max] gi|46326970|gb|AAS... 60 2e-07 ref|XP_003534466.1| PREDICTED: thioredoxin H2-like [Glycine max] 60 2e-07 gb|ACU15762.1| unknown [Glycine max] 60 2e-07 ref|XP_004302361.1| PREDICTED: thioredoxin H2-like [Fragaria ves... 60 3e-07 ref|XP_007215973.1| hypothetical protein PRUPE_ppa011576mg [Prun... 60 3e-07 gb|ACZ37068.1| thioredoxin h4 [Medicago truncatula] 60 3e-07 ref|XP_002517458.1| Thioredoxin H-type, putative [Ricinus commun... 60 3e-07 ref|XP_003621089.1| Thioredoxin h2 [Medicago truncatula] gi|1243... 60 3e-07 ref|XP_006431063.1| hypothetical protein CICLE_v10013081mg [Citr... 60 4e-07 gb|AAY42864.1| thioredoxin H [Nicotiana alata] 60 4e-07 ref|XP_002324032.2| thioredoxin family protein [Populus trichoca... 59 5e-07 ref|XP_007032429.1| Thioredoxin 2 [Theobroma cacao] gi|508711458... 59 5e-07 ref|XP_002282318.1| PREDICTED: thioredoxin H2 [Vitis vinifera] g... 59 5e-07 ref|NP_001237844.1| thioredoxin h2 [Glycine max] gi|157781193|gb... 59 7e-07 >gb|ABG81098.1| thioredoxin H [Pelargonium x hortorum] Length = 53 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/40 (67%), Positives = 36/40 (90%) Frame = -3 Query: 205 AQEFEIEAMPTLVLVKQGREVDRIVGARKDELETKIKMHK 86 A+EF ++AMPT VLVK+G+EVDR+VGA+KDELE KI+ H+ Sbjct: 11 AREFAVQAMPTFVLVKKGKEVDRVVGAKKDELEKKIQKHQ 50 >gb|EXB30121.1| Thioredoxin H2-2 [Morus notabilis] Length = 159 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/40 (65%), Positives = 35/40 (87%) Frame = -3 Query: 205 AQEFEIEAMPTLVLVKQGREVDRIVGARKDELETKIKMHK 86 AQEF ++AMPT VL K+G+EVDR+VGA+KDELE K++ H+ Sbjct: 119 AQEFGVQAMPTFVLTKKGKEVDRVVGAKKDELERKVQKHR 158 >ref|XP_006482526.1| PREDICTED: thioredoxin H2-like [Citrus sinensis] Length = 143 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/44 (61%), Positives = 36/44 (81%) Frame = -3 Query: 205 AQEFEIEAMPTLVLVKQGREVDRIVGARKDELETKIKMHKI*VW 74 AQEF+++AMPT VLVK G+EV+R++GARKDEL KI+ H+ W Sbjct: 94 AQEFQVQAMPTFVLVKGGKEVERVIGARKDELLKKIEKHRAQQW 137 >ref|XP_003552507.1| PREDICTED: thioredoxin H2 [Glycine max] Length = 133 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/40 (65%), Positives = 36/40 (90%) Frame = -3 Query: 205 AQEFEIEAMPTLVLVKQGREVDRIVGARKDELETKIKMHK 86 AQEF+++AMPT VL K+G+EVD++VGA+KDELE KI+ H+ Sbjct: 93 AQEFQVQAMPTFVLWKKGKEVDKVVGAKKDELEKKIEKHR 132 >gb|AAQ23133.1| thioredoxin H2 [Ipomoea batatas] Length = 143 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/40 (67%), Positives = 34/40 (85%) Frame = -3 Query: 205 AQEFEIEAMPTLVLVKQGREVDRIVGARKDELETKIKMHK 86 AQEF ++AMPT +L+KQG+EV R+VGA+KDELE KI HK Sbjct: 97 AQEFSVQAMPTFLLLKQGKEVGRVVGAKKDELERKIVQHK 136 >gb|AGG19195.1| thioredoxin H-type 4, partial [Tamarix hispida] Length = 137 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/40 (67%), Positives = 34/40 (85%) Frame = -3 Query: 205 AQEFEIEAMPTLVLVKQGREVDRIVGARKDELETKIKMHK 86 AQ F ++AMPT VL+KQG+EVDR+VGA+KDELE KI H+ Sbjct: 95 AQGFGVQAMPTFVLLKQGKEVDRVVGAKKDELENKIAKHR 134 >ref|NP_001237440.1| thioredoxin [Glycine max] gi|46326970|gb|AAS88427.1| thioredoxin [Glycine max] Length = 135 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/40 (65%), Positives = 35/40 (87%) Frame = -3 Query: 205 AQEFEIEAMPTLVLVKQGREVDRIVGARKDELETKIKMHK 86 A+EF +EAMPT VL K+G+EVD++VGA+KDELE KI+ H+ Sbjct: 93 AKEFNVEAMPTFVLCKKGKEVDKVVGAKKDELEKKIEKHR 132 >ref|XP_003534466.1| PREDICTED: thioredoxin H2-like [Glycine max] Length = 131 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/39 (66%), Positives = 35/39 (89%) Frame = -3 Query: 205 AQEFEIEAMPTLVLVKQGREVDRIVGARKDELETKIKMH 89 A++F++EAMPT VL K+G+EVDR+VGARKDEL+ KI+ H Sbjct: 91 AKDFKVEAMPTFVLCKKGKEVDRVVGARKDELQNKIQKH 129 >gb|ACU15762.1| unknown [Glycine max] Length = 157 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/40 (65%), Positives = 35/40 (87%) Frame = -3 Query: 205 AQEFEIEAMPTLVLVKQGREVDRIVGARKDELETKIKMHK 86 A+EF +EAMPT VL K+G+EVD++VGA+KDELE KI+ H+ Sbjct: 115 AKEFNVEAMPTFVLCKKGKEVDKVVGAKKDELEKKIEKHR 154 >ref|XP_004302361.1| PREDICTED: thioredoxin H2-like [Fragaria vesca subsp. vesca] Length = 133 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/40 (62%), Positives = 35/40 (87%) Frame = -3 Query: 205 AQEFEIEAMPTLVLVKQGREVDRIVGARKDELETKIKMHK 86 +QEF ++AMPT VL+K G+EVDR+VGA+KDELE K++ H+ Sbjct: 94 SQEFGVQAMPTFVLLKNGKEVDRVVGAKKDELEKKVEKHR 133 >ref|XP_007215973.1| hypothetical protein PRUPE_ppa011576mg [Prunus persica] gi|462412123|gb|EMJ17172.1| hypothetical protein PRUPE_ppa011576mg [Prunus persica] Length = 205 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/40 (65%), Positives = 36/40 (90%) Frame = -3 Query: 205 AQEFEIEAMPTLVLVKQGREVDRIVGARKDELETKIKMHK 86 AQEF ++AMPT VL+K+G+EVDR++GARKDELE KI+ ++ Sbjct: 164 AQEFGVQAMPTFVLLKKGKEVDRVIGARKDELEKKIQKYQ 203 >gb|ACZ37068.1| thioredoxin h4 [Medicago truncatula] Length = 131 Score = 60.1 bits (144), Expect = 3e-07 Identities = 24/40 (60%), Positives = 36/40 (90%) Frame = -3 Query: 205 AQEFEIEAMPTLVLVKQGREVDRIVGARKDELETKIKMHK 86 AQEF+++AMPT +L+K G+EVD++VGA+KDEL+ K++ HK Sbjct: 91 AQEFKVQAMPTFLLLKNGKEVDKVVGAKKDELKNKVQKHK 130 >ref|XP_002517458.1| Thioredoxin H-type, putative [Ricinus communis] gi|223543469|gb|EEF45000.1| Thioredoxin H-type, putative [Ricinus communis] Length = 133 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/40 (67%), Positives = 35/40 (87%) Frame = -3 Query: 205 AQEFEIEAMPTLVLVKQGREVDRIVGARKDELETKIKMHK 86 AQEF ++AMPT VLVK+G+EVDR+VGA+KDEL KI+ H+ Sbjct: 92 AQEFGVQAMPTFVLVKKGKEVDRVVGAKKDELLKKIEKHR 131 >ref|XP_003621089.1| Thioredoxin h2 [Medicago truncatula] gi|124359917|gb|ABN07937.1| Thioredoxin domain 2; Thioredoxin fold [Medicago truncatula] gi|355496104|gb|AES77307.1| Thioredoxin h2 [Medicago truncatula] gi|388514259|gb|AFK45191.1| unknown [Medicago truncatula] Length = 134 Score = 60.1 bits (144), Expect = 3e-07 Identities = 24/40 (60%), Positives = 36/40 (90%) Frame = -3 Query: 205 AQEFEIEAMPTLVLVKQGREVDRIVGARKDELETKIKMHK 86 AQEF+++AMPT +L+K G+EVD++VGA+KDEL+ K++ HK Sbjct: 94 AQEFKVQAMPTFLLLKNGKEVDKVVGAKKDELKNKVQKHK 133 >ref|XP_006431063.1| hypothetical protein CICLE_v10013081mg [Citrus clementina] gi|557533120|gb|ESR44303.1| hypothetical protein CICLE_v10013081mg [Citrus clementina] Length = 136 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/40 (65%), Positives = 35/40 (87%) Frame = -3 Query: 205 AQEFEIEAMPTLVLVKQGREVDRIVGARKDELETKIKMHK 86 AQEF+++AMPT VLVK G+EV+R++GARKDEL KI+ H+ Sbjct: 94 AQEFQVQAMPTFVLVKGGKEVERVIGARKDELLKKIEKHR 133 >gb|AAY42864.1| thioredoxin H [Nicotiana alata] Length = 152 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/40 (65%), Positives = 35/40 (87%) Frame = -3 Query: 205 AQEFEIEAMPTLVLVKQGREVDRIVGARKDELETKIKMHK 86 AQEF ++AMPT +L+KQG+EV+R+VGA+KDELE KI H+ Sbjct: 96 AQEFGVQAMPTFLLLKQGKEVERVVGAKKDELEKKILKHR 135 >ref|XP_002324032.2| thioredoxin family protein [Populus trichocarpa] gi|550320039|gb|EEF04165.2| thioredoxin family protein [Populus trichocarpa] Length = 140 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/40 (65%), Positives = 35/40 (87%) Frame = -3 Query: 205 AQEFEIEAMPTLVLVKQGREVDRIVGARKDELETKIKMHK 86 AQEF ++AMPT VLVK+G EVDR+VGA+K+EL+ KI+ H+ Sbjct: 99 AQEFGVQAMPTFVLVKKGNEVDRVVGAQKEELQRKIEKHR 138 >ref|XP_007032429.1| Thioredoxin 2 [Theobroma cacao] gi|508711458|gb|EOY03355.1| Thioredoxin 2 [Theobroma cacao] Length = 139 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/40 (62%), Positives = 36/40 (90%) Frame = -3 Query: 205 AQEFEIEAMPTLVLVKQGREVDRIVGARKDELETKIKMHK 86 AQEF ++AMPT VLVK+G+EVDR+VGA+K++LE K++ H+ Sbjct: 94 AQEFGVQAMPTFVLVKKGKEVDRVVGAQKNDLEKKVEKHR 133 >ref|XP_002282318.1| PREDICTED: thioredoxin H2 [Vitis vinifera] gi|147821566|emb|CAN70031.1| hypothetical protein VITISV_013686 [Vitis vinifera] gi|296087778|emb|CBI35034.3| unnamed protein product [Vitis vinifera] gi|452114370|gb|AGG09342.1| thioredoxin h4 [Vitis vinifera] Length = 136 Score = 59.3 bits (142), Expect = 5e-07 Identities = 24/40 (60%), Positives = 36/40 (90%) Frame = -3 Query: 205 AQEFEIEAMPTLVLVKQGREVDRIVGARKDELETKIKMHK 86 AQEF ++AMPT VL+K+G+E++R++GA+KDELE KI+ H+ Sbjct: 92 AQEFTVQAMPTFVLLKKGKELERVIGAKKDELEKKIQKHR 131 >ref|NP_001237844.1| thioredoxin h2 [Glycine max] gi|157781193|gb|ABV71992.1| thioredoxin h2 [Glycine max] Length = 130 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/40 (62%), Positives = 36/40 (90%) Frame = -3 Query: 205 AQEFEIEAMPTLVLVKQGREVDRIVGARKDELETKIKMHK 86 AQEF+++AMPT +L+K G+EVD+IVGA+KDEL+ KIK ++ Sbjct: 90 AQEFKVQAMPTFLLLKNGKEVDKIVGAKKDELKNKIKKYR 129