BLASTX nr result
ID: Akebia24_contig00017568
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00017568 (393 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006857106.1| hypothetical protein AMTR_s00065p00126320 [A... 100 8e-22 ref|XP_003591561.1| hypothetical protein MTR_1g088810 [Medicago ... 63 4e-08 >ref|XP_006857106.1| hypothetical protein AMTR_s00065p00126320 [Amborella trichopoda] gi|548861189|gb|ERN18573.1| hypothetical protein AMTR_s00065p00126320 [Amborella trichopoda] Length = 159 Score = 99.8 bits (247), Expect(2) = 8e-22 Identities = 54/79 (68%), Positives = 58/79 (73%) Frame = -1 Query: 267 PPSLELVHSLGDPLLSRSSVCSSFRPVSYISAHCSHLRGSSHLDSTRTLVPRTALPARSP 88 PPSLELVHSLGDPLLSRSSV SSFRPVS ISAHCSHL+ S HLDST+TLVPRTA Sbjct: 43 PPSLELVHSLGDPLLSRSSVFSSFRPVSGISAHCSHLQASLHLDSTKTLVPRTAC----- 97 Query: 87 PYDPQLKMSLATRRGHSPC 31 LK +L T + PC Sbjct: 98 -----LKPALGTTTPNEPC 111 Score = 29.6 bits (65), Expect(2) = 8e-22 Identities = 17/22 (77%), Positives = 17/22 (77%) Frame = -2 Query: 347 GSVSYYRSSDKIRTATSLKAWF 282 G VSY SS K RTATSLKAWF Sbjct: 21 GLVSYSCSSYK-RTATSLKAWF 41 >ref|XP_003591561.1| hypothetical protein MTR_1g088810 [Medicago truncatula] gi|355480609|gb|AES61812.1| hypothetical protein MTR_1g088810 [Medicago truncatula] Length = 444 Score = 63.2 bits (152), Expect = 4e-08 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -1 Query: 315 DSDRHFSESMVLASLSPPSLELVHSLGDPLLSRSS 211 DSDRHFSESMVLA L PPSLEL+HSLGDPLLSR S Sbjct: 149 DSDRHFSESMVLAFLFPPSLELIHSLGDPLLSRWS 183