BLASTX nr result
ID: Akebia24_contig00017416
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00017416 (363 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007024965.1| Auxin response factor 6 isoform 4 [Theobroma... 58 2e-06 ref|XP_007024963.1| Auxin response factor 6 isoform 2 [Theobroma... 58 2e-06 ref|XP_007024962.1| Auxin response factor 6 isoform 1 [Theobroma... 58 2e-06 emb|CBI30949.3| unnamed protein product [Vitis vinifera] 58 2e-06 ref|XP_002279808.1| PREDICTED: auxin response factor 6-like [Vit... 58 2e-06 ref|XP_002298839.1| auxin response factor 6 family protein [Popu... 56 6e-06 >ref|XP_007024965.1| Auxin response factor 6 isoform 4 [Theobroma cacao] gi|508780331|gb|EOY27587.1| Auxin response factor 6 isoform 4 [Theobroma cacao] Length = 604 Score = 57.8 bits (138), Expect = 2e-06 Identities = 30/39 (76%), Positives = 32/39 (82%), Gaps = 2/39 (5%) Frame = -3 Query: 361 LLNSV--QRLSSGSCDDYASLQDSRNRSSGVTSVSSLDY 251 LLNSV QRLS+GSCDDY S QDSRN SSG+ SV SLDY Sbjct: 566 LLNSVPVQRLSNGSCDDYVSRQDSRNLSSGIASVGSLDY 604 >ref|XP_007024963.1| Auxin response factor 6 isoform 2 [Theobroma cacao] gi|508780329|gb|EOY27585.1| Auxin response factor 6 isoform 2 [Theobroma cacao] Length = 902 Score = 57.8 bits (138), Expect = 2e-06 Identities = 30/39 (76%), Positives = 32/39 (82%), Gaps = 2/39 (5%) Frame = -3 Query: 361 LLNSV--QRLSSGSCDDYASLQDSRNRSSGVTSVSSLDY 251 LLNSV QRLS+GSCDDY S QDSRN SSG+ SV SLDY Sbjct: 864 LLNSVPVQRLSNGSCDDYVSRQDSRNLSSGIASVGSLDY 902 >ref|XP_007024962.1| Auxin response factor 6 isoform 1 [Theobroma cacao] gi|508780328|gb|EOY27584.1| Auxin response factor 6 isoform 1 [Theobroma cacao] Length = 899 Score = 57.8 bits (138), Expect = 2e-06 Identities = 30/39 (76%), Positives = 32/39 (82%), Gaps = 2/39 (5%) Frame = -3 Query: 361 LLNSV--QRLSSGSCDDYASLQDSRNRSSGVTSVSSLDY 251 LLNSV QRLS+GSCDDY S QDSRN SSG+ SV SLDY Sbjct: 861 LLNSVPVQRLSNGSCDDYVSRQDSRNLSSGIASVGSLDY 899 >emb|CBI30949.3| unnamed protein product [Vitis vinifera] Length = 160 Score = 57.8 bits (138), Expect = 2e-06 Identities = 30/39 (76%), Positives = 33/39 (84%), Gaps = 2/39 (5%) Frame = -3 Query: 361 LLNSV--QRLSSGSCDDYASLQDSRNRSSGVTSVSSLDY 251 LLNSV QRL+S SCDDYAS QDSRN S+G+TSV SLDY Sbjct: 122 LLNSVPIQRLTSSSCDDYASRQDSRNLSTGITSVGSLDY 160 >ref|XP_002279808.1| PREDICTED: auxin response factor 6-like [Vitis vinifera] Length = 908 Score = 57.8 bits (138), Expect = 2e-06 Identities = 30/39 (76%), Positives = 33/39 (84%), Gaps = 2/39 (5%) Frame = -3 Query: 361 LLNSV--QRLSSGSCDDYASLQDSRNRSSGVTSVSSLDY 251 LLNSV QRL+S SCDDYAS QDSRN S+G+TSV SLDY Sbjct: 870 LLNSVPIQRLTSSSCDDYASRQDSRNLSTGITSVGSLDY 908 >ref|XP_002298839.1| auxin response factor 6 family protein [Populus trichocarpa] gi|222846097|gb|EEE83644.1| auxin response factor 6 family protein [Populus trichocarpa] Length = 884 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/39 (69%), Positives = 34/39 (87%), Gaps = 2/39 (5%) Frame = -3 Query: 361 LLNS--VQRLSSGSCDDYASLQDSRNRSSGVTSVSSLDY 251 LLNS +QRLS+GSCDDYA+ QDS++ S+G+TSV SLDY Sbjct: 846 LLNSFPIQRLSNGSCDDYANRQDSKSSSTGITSVGSLDY 884