BLASTX nr result
ID: Akebia24_contig00017253
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00017253 (291 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006386917.1| hypothetical protein POPTR_0002s26020g [Popu... 55 1e-05 ref|XP_002303119.1| hypothetical protein POPTR_0002s26020g [Popu... 55 1e-05 >ref|XP_006386917.1| hypothetical protein POPTR_0002s26020g [Populus trichocarpa] gi|550345841|gb|ERP64714.1| hypothetical protein POPTR_0002s26020g [Populus trichocarpa] Length = 442 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/40 (65%), Positives = 30/40 (75%) Frame = -2 Query: 242 DEIPILGTVGR*WSHKE*AMDSRSSSSYKGITNTTRKYRE 123 DE+PI+GTVG W+H DS S+SSYKGI NTT KYRE Sbjct: 368 DEMPIIGTVGTYWNHGGSGKDSGSASSYKGIPNTTSKYRE 407 >ref|XP_002303119.1| hypothetical protein POPTR_0002s26020g [Populus trichocarpa] gi|222844845|gb|EEE82392.1| hypothetical protein POPTR_0002s26020g [Populus trichocarpa] Length = 983 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/40 (65%), Positives = 30/40 (75%) Frame = -2 Query: 242 DEIPILGTVGR*WSHKE*AMDSRSSSSYKGITNTTRKYRE 123 DE+PI+GTVG W+H DS S+SSYKGI NTT KYRE Sbjct: 368 DEMPIIGTVGTYWNHGGSGKDSGSASSYKGIPNTTSKYRE 407