BLASTX nr result
ID: Akebia24_contig00017099
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00017099 (659 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002299053.2| hypothetical protein POPTR_0001s47130g [Popu... 59 2e-06 >ref|XP_002299053.2| hypothetical protein POPTR_0001s47130g [Populus trichocarpa] gi|550350064|gb|EEE83858.2| hypothetical protein POPTR_0001s47130g [Populus trichocarpa] Length = 205 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/49 (55%), Positives = 38/49 (77%) Frame = -1 Query: 149 ELDAKSASMTICRLSRRLVLEFMGFNGMVLYVRPALAAPKPELKDPKVI 3 +L K +S+ I RLSRR+VL+F GFN ++L + P LAAP PE+K+P+VI Sbjct: 29 DLHCKFSSLEIKRLSRRMVLKFCGFNTLLLSINPVLAAPMPEMKEPEVI 77