BLASTX nr result
ID: Akebia24_contig00016804
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00016804 (309 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004238590.1| PREDICTED: uncharacterized protein LOC101263... 56 5e-06 ref|XP_007017381.1| Peptidase S24/S26A/S26B/S26C family protein ... 56 6e-06 >ref|XP_004238590.1| PREDICTED: uncharacterized protein LOC101263904 [Solanum lycopersicum] Length = 853 Score = 56.2 bits (134), Expect = 5e-06 Identities = 22/24 (91%), Positives = 24/24 (100%) Frame = -3 Query: 73 LVPEGCVFVLGDNRNNSFDSHNWG 2 LVPEGCVFV+GDNRNNS+DSHNWG Sbjct: 312 LVPEGCVFVMGDNRNNSYDSHNWG 335 >ref|XP_007017381.1| Peptidase S24/S26A/S26B/S26C family protein isoform 4 [Theobroma cacao] gi|508722709|gb|EOY14606.1| Peptidase S24/S26A/S26B/S26C family protein isoform 4 [Theobroma cacao] Length = 418 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/31 (80%), Positives = 27/31 (87%), Gaps = 1/31 (3%) Frame = -3 Query: 91 F*WFV-QLVPEGCVFVLGDNRNNSFDSHNWG 2 F W + Q+VPEG VFVLGDNRNNSFDSHNWG Sbjct: 350 FLWVILQVVPEGYVFVLGDNRNNSFDSHNWG 380