BLASTX nr result
ID: Akebia24_contig00016740
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00016740 (562 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB74718.1| hypothetical protein L484_010996 [Morus notabilis] 55 1e-05 >gb|EXB74718.1| hypothetical protein L484_010996 [Morus notabilis] Length = 509 Score = 55.5 bits (132), Expect = 1e-05 Identities = 35/93 (37%), Positives = 44/93 (47%), Gaps = 8/93 (8%) Frame = +1 Query: 286 MGGCIWAPKGCFXXXXXXXXXXXXXXXXXXXXXXXXXX------DELPDKSSPLDCSRI- 444 MGGC AP+GC E P +S+P+D S I Sbjct: 1 MGGCFSAPQGCVGGGLDSSRKTTSRSRRKRGLKGRVSSRSSEASSERPGRSAPVDRSTIT 60 Query: 445 KPTSQGSTEETWFDSVTIFE-SDGEDDFQNAQN 540 PT QGSTEE WFDS F+ SDG+DD+Q+ Q+ Sbjct: 61 NPTLQGSTEEAWFDSAPRFDFSDGDDDYQSVQD 93