BLASTX nr result
ID: Akebia24_contig00016521
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00016521 (316 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB74570.1| hypothetical protein L484_026267 [Morus notabilis] 68 8e-14 ref|XP_004510058.1| PREDICTED: uncharacterized protein LOC101507... 60 5e-10 ref|XP_003588347.1| NADH-ubiquinone oxidoreductase chain [Medica... 59 1e-09 ref|XP_002535452.1| conserved hypothetical protein [Ricinus comm... 67 3e-09 >gb|EXB74570.1| hypothetical protein L484_026267 [Morus notabilis] Length = 169 Score = 67.8 bits (164), Expect(2) = 8e-14 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -1 Query: 127 PAPGRVSEPCNRRPFRAVRGALESAAGARLRLDP 26 P PGRVSEPCNRRPFRAVRGALESAAGARLRL P Sbjct: 124 PTPGRVSEPCNRRPFRAVRGALESAAGARLRLVP 157 Score = 34.7 bits (78), Expect(2) = 8e-14 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 182 HAANRGPACAGPPTNNRYPRP 120 H A CAGPPTNNRYP P Sbjct: 106 HMACMYSGCAGPPTNNRYPTP 126 >ref|XP_004510058.1| PREDICTED: uncharacterized protein LOC101507236 [Cicer arietinum] Length = 614 Score = 59.7 bits (143), Expect(2) = 5e-10 Identities = 29/41 (70%), Positives = 32/41 (78%) Frame = -2 Query: 129 PPPQAELVSRVIGDHFARFGGHLSQPPAPGCVLTPIQFLGQ 7 P PQAELVSRVIGDHFARFGGHLSQPP +L +F+ Q Sbjct: 54 PTPQAELVSRVIGDHFARFGGHLSQPP----ILAESEFVAQ 90 Score = 29.6 bits (65), Expect(2) = 5e-10 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 157 APDRRRIIGTPAP 119 APDRRRIIGTP P Sbjct: 44 APDRRRIIGTPTP 56 >ref|XP_003588347.1| NADH-ubiquinone oxidoreductase chain [Medicago truncatula] gi|355477395|gb|AES58598.1| NADH-ubiquinone oxidoreductase chain [Medicago truncatula] Length = 339 Score = 58.5 bits (140), Expect(2) = 1e-09 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = -2 Query: 129 PPPQAELVSRVIGDHFARFGGHLSQPP 49 P PQAELVSRVIGDHFARFGGHLSQPP Sbjct: 54 PTPQAELVSRVIGDHFARFGGHLSQPP 80 Score = 29.6 bits (65), Expect(2) = 1e-09 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 157 APDRRRIIGTPAP 119 APDRRRIIGTP P Sbjct: 44 APDRRRIIGTPTP 56 >ref|XP_002535452.1| conserved hypothetical protein [Ricinus communis] gi|223523063|gb|EEF26931.1| conserved hypothetical protein [Ricinus communis] Length = 55 Score = 67.0 bits (162), Expect = 3e-09 Identities = 32/35 (91%), Positives = 32/35 (91%) Frame = +1 Query: 4 ELAQKLDRGQDAAGRRRLTQVPPEPREMVAYYTAH 108 ELAQK DRGQDA GRRRLTQVP EPREMVAYYTAH Sbjct: 21 ELAQKWDRGQDAVGRRRLTQVPLEPREMVAYYTAH 55