BLASTX nr result
ID: Akebia24_contig00015876
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00015876 (791 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAA84682.1| unknown protein (chloroplast) [Nicotiana tabacum]... 77 7e-12 gb|EYU35473.1| hypothetical protein MIMGU_mgv11b021317mg [Mimulu... 57 6e-06 >gb|AAA84682.1| unknown protein (chloroplast) [Nicotiana tabacum] gi|224352|prf||1102209F ORF 6 Length = 79 Score = 77.0 bits (188), Expect = 7e-12 Identities = 47/84 (55%), Positives = 56/84 (66%), Gaps = 3/84 (3%) Frame = -1 Query: 770 MKVDYLPIHFKTSMISSRTKHESFDSFGSHAQLLMYLWSIPLAFF*CNEPI---LFCSYS 600 MKVDY I F+ S+I SRTKHESFDSFGSHAQLL + + F+ CNEPI LF Sbjct: 1 MKVDYFSIPFQNSIIPSRTKHESFDSFGSHAQLLKV--NSHIFFYECNEPIFSSLFIFQK 58 Query: 599 NI*KLIIDPRP*YSEDSSDQTKNL 528 +I +I P YSEDSSD+ KN+ Sbjct: 59 DIETNVI---PKYSEDSSDKIKNM 79 >gb|EYU35473.1| hypothetical protein MIMGU_mgv11b021317mg [Mimulus guttatus] Length = 70 Score = 57.4 bits (137), Expect = 6e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -1 Query: 770 MKVDYLPIHFKTSMISSRTKHESFDSFGSHAQLL 669 MKVDYL +HFK S+I SRTKHES DSFGSH QLL Sbjct: 1 MKVDYLFVHFKASIIPSRTKHESKDSFGSHVQLL 34