BLASTX nr result
ID: Akebia24_contig00015250
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00015250 (358 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007035646.1| Plant invertase/pectin methylesterase inhibi... 64 2e-08 ref|XP_007140263.1| hypothetical protein PHAVU_008G097400g [Phas... 60 3e-07 ref|XP_002527490.1| conserved hypothetical protein [Ricinus comm... 58 1e-06 ref|XP_002527491.1| conserved hypothetical protein [Ricinus comm... 56 5e-06 ref|XP_003616977.1| hypothetical protein MTR_5g086360 [Medicago ... 56 6e-06 ref|XP_006387178.1| hypothetical protein POPTR_1605s00200g [Popu... 55 8e-06 >ref|XP_007035646.1| Plant invertase/pectin methylesterase inhibitor superfamily, putative [Theobroma cacao] gi|508714675|gb|EOY06572.1| Plant invertase/pectin methylesterase inhibitor superfamily, putative [Theobroma cacao] Length = 686 Score = 64.3 bits (155), Expect = 2e-08 Identities = 38/78 (48%), Positives = 42/78 (53%), Gaps = 5/78 (6%) Frame = +3 Query: 114 HHRVILPLLRAGSVRCSVKPA*RGLLRFKNQLTQAFARINWINSQLGTGETEITSISPYH 293 H VILPL S RCSVKPA RG L +NQ QA+AR W N QLGTG+ E PY Sbjct: 2 HWLVILPLFVTESFRCSVKPASRGALLSRNQEAQAYARTPWFNYQLGTGKPESRIHGPYQ 61 Query: 294 S-----ESNYCPTTLMSP 332 +S PT L P Sbjct: 62 GGSDTVQSPNAPTRLPKP 79 >ref|XP_007140263.1| hypothetical protein PHAVU_008G097400g [Phaseolus vulgaris] gi|561013396|gb|ESW12257.1| hypothetical protein PHAVU_008G097400g [Phaseolus vulgaris] Length = 61 Score = 60.1 bits (144), Expect = 3e-07 Identities = 31/55 (56%), Positives = 35/55 (63%) Frame = +3 Query: 123 VILPLLRAGSVRCSVKPA*RGLLRFKNQLTQAFARINWINSQLGTGETEITSISP 287 VI PL GS RCSV PA R L F+NQ TQAFA++ W NSQLG G + SP Sbjct: 5 VIPPLSGEGSFRCSVNPASRCALHFRNQETQAFAQVPWFNSQLGVGRPAFRNQSP 59 >ref|XP_002527490.1| conserved hypothetical protein [Ricinus communis] gi|223533130|gb|EEF34888.1| conserved hypothetical protein [Ricinus communis] Length = 60 Score = 58.2 bits (139), Expect = 1e-06 Identities = 33/60 (55%), Positives = 36/60 (60%) Frame = -3 Query: 293 MVWTDGGDLCLARSKL*VDPIDSSEGLS*LVLKAEETASGWFHRAAYTSRSQQWKDNAMV 114 M+W LARSKL VDP EG + +AE TA GWFHRAA TS S QWKDN V Sbjct: 1 MIW-------LARSKLRVDPCGLGEGPGSMGPRAEGTALGWFHRAAITSLSWQWKDNGPV 53 >ref|XP_002527491.1| conserved hypothetical protein [Ricinus communis] gi|223533131|gb|EEF34889.1| conserved hypothetical protein [Ricinus communis] Length = 101 Score = 56.2 bits (134), Expect = 5e-06 Identities = 39/84 (46%), Positives = 47/84 (55%), Gaps = 2/84 (2%) Frame = +3 Query: 111 RHHRVILPLLRAGSVRCSVKPA*RGLLRFKNQLTQAFAR--INWINSQLGTGETEITSIS 284 RH VILPL RAG RCSVKPA R LR +NQ+T AFA+ I +++ G + Sbjct: 16 RHQLVILPLPRAGGCRCSVKPASRCALRSRNQVTPAFAQGHIAQLSAWNGRARAQPHQGR 75 Query: 285 PYHSESNYCPTTLMSPLGLQANVT 356 P E P TLM L LQA+ T Sbjct: 76 PTGPEQR--PITLMPLLRLQAHAT 97 >ref|XP_003616977.1| hypothetical protein MTR_5g086360 [Medicago truncatula] gi|355518312|gb|AES99935.1| hypothetical protein MTR_5g086360 [Medicago truncatula] Length = 81 Score = 55.8 bits (133), Expect = 6e-06 Identities = 30/64 (46%), Positives = 38/64 (59%) Frame = +3 Query: 123 VILPLLRAGSVRCSVKPA*RGLLRFKNQLTQAFARINWINSQLGTGETEITSISPYHSES 302 VI PL RA +RCS KPA R L +NQ T+AFA+I W NSQLG G+ P + Sbjct: 16 VIPPLSRARGLRCSAKPASRSALSSRNQETKAFAQIPWPNSQLGEGKPTYCRNQPSPTSH 75 Query: 303 NYCP 314 ++ P Sbjct: 76 SHVP 79 >ref|XP_006387178.1| hypothetical protein POPTR_1605s00200g [Populus trichocarpa] gi|550305511|gb|ERP46092.1| hypothetical protein POPTR_1605s00200g [Populus trichocarpa] Length = 72 Score = 55.5 bits (132), Expect = 8e-06 Identities = 30/53 (56%), Positives = 35/53 (66%) Frame = -1 Query: 271 ISVSPVPSCELIQLIRAKA*VNWFLKRRRPRQAGFTEQRTLPALNSGRITRWC 113 +S PVPS EL Q I K V+W L+ R R+AG TEQR+LPA SGRIT C Sbjct: 11 LSGPPVPSQELSQGILVKTWVSWLLEGRAQREAGLTEQRSLPAPGSGRITGRC 63