BLASTX nr result
ID: Akebia24_contig00015164
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00015164 (1033 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN83672.1| hypothetical protein VITISV_009834 [Vitis vinifera] 58 6e-06 ref|XP_006856230.1| hypothetical protein AMTR_s00059p00209410 [A... 57 9e-06 >emb|CAN83672.1| hypothetical protein VITISV_009834 [Vitis vinifera] Length = 942 Score = 58.2 bits (139), Expect = 6e-06 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = +2 Query: 923 LFGFMHFSLWKPISHCAALFLEKKNKRRDGSGGLTEE 1033 L FMH SLWKPISHCAAL L KK +RRDGS GLTE+ Sbjct: 46 LSAFMHISLWKPISHCAALILVKKGRRRDGS-GLTED 81 >ref|XP_006856230.1| hypothetical protein AMTR_s00059p00209410 [Amborella trichopoda] gi|548860089|gb|ERN17697.1| hypothetical protein AMTR_s00059p00209410 [Amborella trichopoda] Length = 936 Score = 57.4 bits (137), Expect = 9e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +2 Query: 935 MHFSLWKPISHCAALFLEKKNKRRDGSGGLTEE 1033 MH SLWKPISHCAAL +EKK+K++DGS GLTEE Sbjct: 1 MHLSLWKPISHCAALIMEKKSKKKDGS-GLTEE 32