BLASTX nr result
ID: Akebia24_contig00014578
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00014578 (309 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002302797.1| Encodes APG8 family protein [Populus trichoc... 62 8e-08 gb|EXB44446.1| hypothetical protein L484_013864 [Morus notabilis] 60 4e-07 ref|XP_006444590.1| hypothetical protein CICLE_v10022874mg [Citr... 59 5e-07 ref|XP_007051247.1| Ubiquitin-like superfamily protein [Theobrom... 59 9e-07 ref|XP_002885095.1| hypothetical protein ARALYDRAFT_479007 [Arab... 58 1e-06 ref|XP_007221508.1| hypothetical protein PRUPE_ppa011964mg [Prun... 58 2e-06 ref|NP_001275429.1| autophagy-related protein 8i-like [Solanum t... 58 2e-06 ref|NP_001234639.1| autophagy 8h [Solanum lycopersicum] gi|32636... 58 2e-06 ref|XP_006406950.1| hypothetical protein EUTSA_v10021792mg [Eutr... 57 3e-06 ref|NP_566518.1| autophagy-related protein 8i [Arabidopsis thali... 57 3e-06 dbj|BAJ13304.1| autophagy 8 [Ipomoea nil] 57 3e-06 ref|XP_006841565.1| hypothetical protein AMTR_s00003p00185030 [A... 57 3e-06 ref|XP_006298788.1| hypothetical protein CARUB_v10014891mg, part... 57 3e-06 ref|XP_002316073.1| hypothetical protein POPTR_0010s16320g [Popu... 57 3e-06 ref|XP_002311361.1| hypothetical protein POPTR_0008s09880g [Popu... 57 3e-06 gb|EXB80282.1| hypothetical protein L484_025138 [Morus notabilis] 56 5e-06 ref|XP_004508094.1| PREDICTED: autophagy-related protein 8i-like... 56 5e-06 ref|XP_004288369.1| PREDICTED: autophagy-related protein 8i-like... 56 5e-06 dbj|BAM62967.1| autophagy 8d [Petunia x hybrida] 56 5e-06 emb|CBI37015.3| unnamed protein product [Vitis vinifera] 56 5e-06 >ref|XP_002302797.1| Encodes APG8 family protein [Populus trichocarpa] gi|222844523|gb|EEE82070.1| Encodes APG8 family protein [Populus trichocarpa] Length = 122 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +3 Query: 3 TASLLDAVYESSKDEDGFLYMCYSSEKTFG*AVP 104 TA+L+D+VYES KDEDGFLYMCYSSEKTFG VP Sbjct: 87 TAALMDSVYESLKDEDGFLYMCYSSEKTFGHTVP 120 >gb|EXB44446.1| hypothetical protein L484_013864 [Morus notabilis] Length = 127 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +3 Query: 3 TASLLDAVYESSKDEDGFLYMCYSSEKTFG 92 TA+L+D VYESSKDEDGFLYMCYS+EKTFG Sbjct: 89 TATLMDLVYESSKDEDGFLYMCYSTEKTFG 118 >ref|XP_006444590.1| hypothetical protein CICLE_v10022874mg [Citrus clementina] gi|568878843|ref|XP_006492394.1| PREDICTED: autophagy-related protein 8i-like [Citrus sinensis] gi|557546852|gb|ESR57830.1| hypothetical protein CICLE_v10022874mg [Citrus clementina] Length = 125 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +3 Query: 3 TASLLDAVYESSKDEDGFLYMCYSSEKTFG 92 TA+L+D+VYES KDEDGFLYMCYSSEKTFG Sbjct: 89 TATLMDSVYESFKDEDGFLYMCYSSEKTFG 118 >ref|XP_007051247.1| Ubiquitin-like superfamily protein [Theobroma cacao] gi|508703508|gb|EOX95404.1| Ubiquitin-like superfamily protein [Theobroma cacao] Length = 127 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = +3 Query: 3 TASLLDAVYESSKDEDGFLYMCYSSEKTFG*AVPHVF 113 TA+L+D+VYES K++DGFLYMCYSSEKTFG A +F Sbjct: 89 TATLMDSVYESFKEDDGFLYMCYSSEKTFGCASNQIF 125 >ref|XP_002885095.1| hypothetical protein ARALYDRAFT_479007 [Arabidopsis lyrata subsp. lyrata] gi|297330935|gb|EFH61354.1| hypothetical protein ARALYDRAFT_479007 [Arabidopsis lyrata subsp. lyrata] Length = 115 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +3 Query: 3 TASLLDAVYESSKDEDGFLYMCYSSEKTFG 92 TA+L+D+VYES KDEDGF+YMCYSSEKTFG Sbjct: 86 TAALMDSVYESYKDEDGFVYMCYSSEKTFG 115 >ref|XP_007221508.1| hypothetical protein PRUPE_ppa011964mg [Prunus persica] gi|462418258|gb|EMJ22707.1| hypothetical protein PRUPE_ppa011964mg [Prunus persica] Length = 189 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +3 Query: 3 TASLLDAVYESSKDEDGFLYMCYSSEKTFG 92 TASL+D+VYES KD+DGFLYMCYS+EKTFG Sbjct: 150 TASLMDSVYESFKDKDGFLYMCYSTEKTFG 179 >ref|NP_001275429.1| autophagy-related protein 8i-like [Solanum tuberosum] gi|413968534|gb|AFW90604.1| autophagy 8h [Solanum tuberosum] Length = 119 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 3 TASLLDAVYESSKDEDGFLYMCYSSEKTFG 92 T SL++ VYESSKD+DGFLYMCYSSEKTFG Sbjct: 87 TTSLIETVYESSKDKDGFLYMCYSSEKTFG 116 >ref|NP_001234639.1| autophagy 8h [Solanum lycopersicum] gi|326367391|gb|ADZ55308.1| autophagy 8h [Solanum lycopersicum] Length = 119 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 3 TASLLDAVYESSKDEDGFLYMCYSSEKTFG 92 T SL++ VYESSKD+DGFLYMCYSSEKTFG Sbjct: 87 TTSLIETVYESSKDKDGFLYMCYSSEKTFG 116 >ref|XP_006406950.1| hypothetical protein EUTSA_v10021792mg [Eutrema salsugineum] gi|557108096|gb|ESQ48403.1| hypothetical protein EUTSA_v10021792mg [Eutrema salsugineum] Length = 115 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = +3 Query: 3 TASLLDAVYESSKDEDGFLYMCYSSEKTFG 92 TA+L+D+VYE+ KDEDGF+YMCYSSEKTFG Sbjct: 86 TAALMDSVYETYKDEDGFVYMCYSSEKTFG 115 >ref|NP_566518.1| autophagy-related protein 8i [Arabidopsis thaliana] gi|75273797|sp|Q9LRP7.1|ATG8I_ARATH RecName: Full=Autophagy-related protein 8i; AltName: Full=Autophagy-related ubiquitin-like modifier ATG8i; Short=AtAPG8i; Short=Protein autophagy 8i gi|21636958|gb|AAM70189.1|AF492760_1 autophagy APG8 [Arabidopsis thaliana] gi|11994225|dbj|BAB01347.1| unnamed protein product [Arabidopsis thaliana] gi|19912167|dbj|BAB88395.1| autophagy 8i [Arabidopsis thaliana] gi|21554285|gb|AAM63360.1| putative microtubule-associated protein [Arabidopsis thaliana] gi|88011043|gb|ABD38893.1| At3g15580 [Arabidopsis thaliana] gi|332642174|gb|AEE75695.1| autophagy-related protein 8i [Arabidopsis thaliana] Length = 115 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = +3 Query: 3 TASLLDAVYESSKDEDGFLYMCYSSEKTFG 92 TA+L+D+VYES KD+DGF+YMCYSSEKTFG Sbjct: 86 TAALMDSVYESYKDDDGFVYMCYSSEKTFG 115 >dbj|BAJ13304.1| autophagy 8 [Ipomoea nil] Length = 125 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = +3 Query: 3 TASLLDAVYESSKDEDGFLYMCYSSEKTFG 92 T++++D+VYES KDEDGFLYMCYSSEKTFG Sbjct: 91 TSAVMDSVYESFKDEDGFLYMCYSSEKTFG 120 >ref|XP_006841565.1| hypothetical protein AMTR_s00003p00185030 [Amborella trichopoda] gi|548843586|gb|ERN03240.1| hypothetical protein AMTR_s00003p00185030 [Amborella trichopoda] Length = 88 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +3 Query: 3 TASLLDAVYESSKDEDGFLYMCYSSEKTFG 92 TASL ++Y SSKDEDGFLYMCYSSEKTFG Sbjct: 59 TASLTGSIYSSSKDEDGFLYMCYSSEKTFG 88 >ref|XP_006298788.1| hypothetical protein CARUB_v10014891mg, partial [Capsella rubella] gi|565482298|ref|XP_006298789.1| hypothetical protein CARUB_v10014891mg, partial [Capsella rubella] gi|482567497|gb|EOA31686.1| hypothetical protein CARUB_v10014891mg, partial [Capsella rubella] gi|482567498|gb|EOA31687.1| hypothetical protein CARUB_v10014891mg, partial [Capsella rubella] Length = 136 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = +3 Query: 3 TASLLDAVYESSKDEDGFLYMCYSSEKTFG 92 TA+L+D+VYES K+EDGF+YMCYSSEKTFG Sbjct: 107 TAALMDSVYESYKEEDGFVYMCYSSEKTFG 136 >ref|XP_002316073.1| hypothetical protein POPTR_0010s16320g [Populus trichocarpa] gi|222865113|gb|EEF02244.1| hypothetical protein POPTR_0010s16320g [Populus trichocarpa] Length = 118 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +3 Query: 3 TASLLDAVYESSKDEDGFLYMCYSSEKTFG 92 TAS +D++YES KD+DGFLYMCYSSEKTFG Sbjct: 89 TASQMDSIYESYKDDDGFLYMCYSSEKTFG 118 >ref|XP_002311361.1| hypothetical protein POPTR_0008s09880g [Populus trichocarpa] gi|222851181|gb|EEE88728.1| hypothetical protein POPTR_0008s09880g [Populus trichocarpa] Length = 118 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +3 Query: 3 TASLLDAVYESSKDEDGFLYMCYSSEKTFG 92 TAS +D++YES KD+DGFLYMCYSSEKTFG Sbjct: 89 TASQMDSIYESYKDDDGFLYMCYSSEKTFG 118 >gb|EXB80282.1| hypothetical protein L484_025138 [Morus notabilis] Length = 96 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +3 Query: 3 TASLLDAVYESSKDEDGFLYMCYSSEKTFG 92 TAS +D VYE+ KDEDGFLYMCYSSEKTFG Sbjct: 67 TASCMDFVYETYKDEDGFLYMCYSSEKTFG 96 >ref|XP_004508094.1| PREDICTED: autophagy-related protein 8i-like [Cicer arietinum] Length = 118 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = +3 Query: 3 TASLLDAVYESSKDEDGFLYMCYSSEKTFG 92 TASL+++VY++ KDEDGFLYMCYSSEKTFG Sbjct: 89 TASLMNSVYQTYKDEDGFLYMCYSSEKTFG 118 >ref|XP_004288369.1| PREDICTED: autophagy-related protein 8i-like [Fragaria vesca subsp. vesca] Length = 121 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 3 TASLLDAVYESSKDEDGFLYMCYSSEKTFG 92 TASL++ VYES KDEDGFLYMCYS+EKTFG Sbjct: 89 TASLMNFVYESYKDEDGFLYMCYSTEKTFG 118 >dbj|BAM62967.1| autophagy 8d [Petunia x hybrida] Length = 118 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +3 Query: 3 TASLLDAVYESSKDEDGFLYMCYSSEKTFG 92 T SL++AVY+S KD+DGFLYMCYSSEKTFG Sbjct: 87 TTSLIEAVYDSFKDDDGFLYMCYSSEKTFG 116 >emb|CBI37015.3| unnamed protein product [Vitis vinifera] Length = 124 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +3 Query: 3 TASLLDAVYESSKDEDGFLYMCYSSEKTFG 92 TASL+D VYES KDEDGFLYM YSSEKTFG Sbjct: 86 TASLMDTVYESFKDEDGFLYMSYSSEKTFG 115