BLASTX nr result
ID: Akebia24_contig00013988
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00013988 (644 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525167.1| DNA-binding protein S1FA, putative [Ricinus ... 57 6e-06 >ref|XP_002525167.1| DNA-binding protein S1FA, putative [Ricinus communis] gi|223535464|gb|EEF37133.1| DNA-binding protein S1FA, putative [Ricinus communis] Length = 89 Score = 56.6 bits (135), Expect = 6e-06 Identities = 34/75 (45%), Positives = 39/75 (52%), Gaps = 1/75 (1%) Frame = -2 Query: 526 FEQMGNV-KDLETKGFNPXXXXXXXXXXXXXXXXXGNYVLYIYAQXXXXXXXXXXXXXXX 350 F+ MGNV KD+ETKGFNP GNYVLY+YAQ Sbjct: 15 FQNMGNVVKDVETKGFNPGLIVLLVIGGIVLTFLIGNYVLYMYAQKTLPPKKKKPVSKKK 74 Query: 349 XXKERLKQGVSAPGE 305 +ERL+QGVSAPGE Sbjct: 75 MKRERLRQGVSAPGE 89