BLASTX nr result
ID: Akebia24_contig00013884
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00013884 (346 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007046263.1| Copper transport protein family, putative [T... 62 6e-08 ref|XP_002529124.1| conserved hypothetical protein [Ricinus comm... 57 2e-06 ref|XP_003614537.1| hypothetical protein MTR_5g055200 [Medicago ... 57 3e-06 ref|XP_002282260.1| PREDICTED: uncharacterized protein LOC100266... 55 8e-06 >ref|XP_007046263.1| Copper transport protein family, putative [Theobroma cacao] gi|508710198|gb|EOY02095.1| Copper transport protein family, putative [Theobroma cacao] Length = 275 Score = 62.4 bits (150), Expect = 6e-08 Identities = 33/56 (58%), Positives = 40/56 (71%), Gaps = 3/56 (5%) Frame = +3 Query: 186 MTLVDQGKK---KLRVNKSKRLQLGGTTLASVESLAMPLVHEVVLTADLGCMECQK 344 M Q KK ++ +NK K L L GT LASVESL+MPLVHEVVL+AD+ C ECQ+ Sbjct: 95 MVFPGQAKKEVPRVELNKPKSLLLPGTCLASVESLSMPLVHEVVLSADIRCAECQR 150 >ref|XP_002529124.1| conserved hypothetical protein [Ricinus communis] gi|223531403|gb|EEF33237.1| conserved hypothetical protein [Ricinus communis] Length = 119 Score = 57.4 bits (137), Expect = 2e-06 Identities = 31/56 (55%), Positives = 39/56 (69%), Gaps = 3/56 (5%) Frame = +3 Query: 186 MTLVDQGKK---KLRVNKSKRLQLGGTTLASVESLAMPLVHEVVLTADLGCMECQK 344 M L ++ KK K K K + L GT+LASVESL++PLV EVVL+AD+ C ECQK Sbjct: 1 MALANRSKKETSKTGFKKPKSMLLTGTSLASVESLSLPLVQEVVLSADIRCSECQK 56 >ref|XP_003614537.1| hypothetical protein MTR_5g055200 [Medicago truncatula] gi|355515872|gb|AES97495.1| hypothetical protein MTR_5g055200 [Medicago truncatula] Length = 121 Score = 57.0 bits (136), Expect = 3e-06 Identities = 29/56 (51%), Positives = 38/56 (67%), Gaps = 3/56 (5%) Frame = +3 Query: 186 MTLVDQGKKKLR---VNKSKRLQLGGTTLASVESLAMPLVHEVVLTADLGCMECQK 344 M D K +L+ + SK L GT+LAS+ESL+MP VHEVVL+AD+ C +CQK Sbjct: 1 MAFKDSAKSELQEIAIKSSKNFPLFGTSLASIESLSMPKVHEVVLSADMQCEKCQK 56 >ref|XP_002282260.1| PREDICTED: uncharacterized protein LOC100266408 [Vitis vinifera] gi|147856928|emb|CAN78631.1| hypothetical protein VITISV_000032 [Vitis vinifera] gi|297737835|emb|CBI27036.3| unnamed protein product [Vitis vinifera] Length = 113 Score = 55.5 bits (132), Expect = 8e-06 Identities = 29/56 (51%), Positives = 40/56 (71%), Gaps = 3/56 (5%) Frame = +3 Query: 186 MTLVDQGKKKLRV---NKSKRLQLGGTTLASVESLAMPLVHEVVLTADLGCMECQK 344 M +V+ KK+L + +S+ Q+ TTLASVESL MPL+ EVV++AD C+ECQK Sbjct: 1 MAVVNGVKKELPIIGFKRSRSSQIHRTTLASVESLTMPLIQEVVISADFQCVECQK 56