BLASTX nr result
ID: Akebia24_contig00013866
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00013866 (817 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI30945.3| unnamed protein product [Vitis vinifera] 68 5e-09 ref|XP_002272135.1| PREDICTED: pentatricopeptide repeat-containi... 68 5e-09 emb|CAN80625.1| hypothetical protein VITISV_032617 [Vitis vinifera] 68 5e-09 gb|EXC33985.1| Pentatricopeptide repeat-containing protein [Moru... 67 1e-08 ref|XP_004293531.1| PREDICTED: pentatricopeptide repeat-containi... 60 1e-06 gb|EYU33400.1| hypothetical protein MIMGU_mgv1a023529mg [Mimulus... 59 2e-06 ref|XP_006468264.1| PREDICTED: pentatricopeptide repeat-containi... 59 2e-06 ref|XP_006448964.1| hypothetical protein CICLE_v10014263mg [Citr... 59 2e-06 ref|XP_007214696.1| hypothetical protein PRUPE_ppa026763mg, part... 59 2e-06 ref|XP_002531431.1| pentatricopeptide repeat-containing protein,... 59 2e-06 ref|XP_004485976.1| PREDICTED: pentatricopeptide repeat-containi... 57 6e-06 >emb|CBI30945.3| unnamed protein product [Vitis vinifera] Length = 796 Score = 67.8 bits (164), Expect = 5e-09 Identities = 35/56 (62%), Positives = 40/56 (71%), Gaps = 2/56 (3%) Frame = -1 Query: 163 DLFNRNSRQGG--DSGRVGEVDELDEESRHPLVREICRLIELRQAWNPKLEGELRH 2 DL NS GG + + + ++ESRHPLVREICRLIELR AWNPKLEGELRH Sbjct: 133 DLMVLNSFTGGYRQTEGIRRFEGGEDESRHPLVREICRLIELRSAWNPKLEGELRH 188 >ref|XP_002272135.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Vitis vinifera] Length = 733 Score = 67.8 bits (164), Expect = 5e-09 Identities = 35/56 (62%), Positives = 40/56 (71%), Gaps = 2/56 (3%) Frame = -1 Query: 163 DLFNRNSRQGG--DSGRVGEVDELDEESRHPLVREICRLIELRQAWNPKLEGELRH 2 DL NS GG + + + ++ESRHPLVREICRLIELR AWNPKLEGELRH Sbjct: 39 DLMVLNSFTGGYRQTEGIRRFEGGEDESRHPLVREICRLIELRSAWNPKLEGELRH 94 >emb|CAN80625.1| hypothetical protein VITISV_032617 [Vitis vinifera] Length = 733 Score = 67.8 bits (164), Expect = 5e-09 Identities = 35/56 (62%), Positives = 40/56 (71%), Gaps = 2/56 (3%) Frame = -1 Query: 163 DLFNRNSRQGG--DSGRVGEVDELDEESRHPLVREICRLIELRQAWNPKLEGELRH 2 DL NS GG + + + ++ESRHPLVREICRLIELR AWNPKLEGELRH Sbjct: 39 DLMVLNSFTGGYRQTEGIRRFEGGEDESRHPLVREICRLIELRSAWNPKLEGELRH 94 >gb|EXC33985.1| Pentatricopeptide repeat-containing protein [Morus notabilis] Length = 898 Score = 66.6 bits (161), Expect = 1e-08 Identities = 32/56 (57%), Positives = 41/56 (73%) Frame = -1 Query: 169 VLDLFNRNSRQGGDSGRVGEVDELDEESRHPLVREICRLIELRQAWNPKLEGELRH 2 VL+L NRN Q + VG ++E + + RHPLVRE+CRL++LR WNPK EGELRH Sbjct: 108 VLNLSNRNIAQREN---VGRIEEDEGQLRHPLVREVCRLVDLRSTWNPKHEGELRH 160 >ref|XP_004293531.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53700, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 734 Score = 59.7 bits (143), Expect = 1e-06 Identities = 31/52 (59%), Positives = 36/52 (69%), Gaps = 1/52 (1%) Frame = -1 Query: 154 NRNSRQGGDSGRV-GEVDELDEESRHPLVREICRLIELRQAWNPKLEGELRH 2 NR + G GRV G D ++E RHPLVRE+ RLIE+R AW PK EGELRH Sbjct: 42 NRVCEERGKLGRVEGGGDGDEDEYRHPLVREVGRLIEMRTAWTPKFEGELRH 93 >gb|EYU33400.1| hypothetical protein MIMGU_mgv1a023529mg [Mimulus guttatus] Length = 767 Score = 59.3 bits (142), Expect = 2e-06 Identities = 32/57 (56%), Positives = 40/57 (70%) Frame = -1 Query: 172 RVLDLFNRNSRQGGDSGRVGEVDELDEESRHPLVREICRLIELRQAWNPKLEGELRH 2 RVL+ F+RN R+ D R EVDE +E RHPLVRE+CRLI LR +W P LE E ++ Sbjct: 121 RVLNSFDRN-RERSDVSRRIEVDE--DEVRHPLVREVCRLIGLRASWTPNLESEFKN 174 >ref|XP_006468264.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like [Citrus sinensis] Length = 837 Score = 59.3 bits (142), Expect = 2e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -1 Query: 97 DEESRHPLVREICRLIELRQAWNPKLEGELRH 2 ++E RHPLVRE+CRLIELR AW+PKLEGELR+ Sbjct: 165 EDEFRHPLVREVCRLIELRSAWSPKLEGELRN 196 >ref|XP_006448964.1| hypothetical protein CICLE_v10014263mg [Citrus clementina] gi|557551575|gb|ESR62204.1| hypothetical protein CICLE_v10014263mg [Citrus clementina] Length = 837 Score = 59.3 bits (142), Expect = 2e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -1 Query: 97 DEESRHPLVREICRLIELRQAWNPKLEGELRH 2 ++E RHPLVRE+CRLIELR AW+PKLEGELR+ Sbjct: 165 EDEFRHPLVREVCRLIELRSAWSPKLEGELRN 196 >ref|XP_007214696.1| hypothetical protein PRUPE_ppa026763mg, partial [Prunus persica] gi|462410561|gb|EMJ15895.1| hypothetical protein PRUPE_ppa026763mg, partial [Prunus persica] Length = 802 Score = 59.3 bits (142), Expect = 2e-06 Identities = 29/51 (56%), Positives = 36/51 (70%), Gaps = 7/51 (13%) Frame = -1 Query: 133 GDSGRVGE-------VDELDEESRHPLVREICRLIELRQAWNPKLEGELRH 2 G S RV E V+ ++E RHPLVRE+CRL+ELR WNPKLEG+LR+ Sbjct: 111 GSSNRVHEQKENFVRVEGDEDEFRHPLVREVCRLLELRSGWNPKLEGQLRN 161 >ref|XP_002531431.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223528950|gb|EEF30943.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 737 Score = 59.3 bits (142), Expect = 2e-06 Identities = 28/50 (56%), Positives = 34/50 (68%) Frame = -1 Query: 154 NRNSRQGGDSGRVGEVDELDEESRHPLVREICRLIELRQAWNPKLEGELR 5 N SR G + ++ +EE RHPLVRE+CRLIE R AWN KLEG+LR Sbjct: 46 NSVSRNCGQKEDIWRIEIEEEEFRHPLVREVCRLIERRSAWNAKLEGDLR 95 >ref|XP_004485976.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, chloroplastic-like [Cicer arietinum] Length = 784 Score = 57.4 bits (137), Expect = 6e-06 Identities = 26/35 (74%), Positives = 28/35 (80%), Gaps = 1/35 (2%) Frame = -1 Query: 103 ELDE-ESRHPLVREICRLIELRQAWNPKLEGELRH 2 E+DE E RHPLVRE+CRLI LR WNPK EG LRH Sbjct: 113 EIDESEFRHPLVREVCRLITLRSTWNPKFEGNLRH 147