BLASTX nr result
ID: Akebia24_contig00013559
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00013559 (462 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB53704.1| hypothetical protein L484_008988 [Morus notabilis] 58 2e-06 >gb|EXB53704.1| hypothetical protein L484_008988 [Morus notabilis] Length = 1030 Score = 57.8 bits (138), Expect = 2e-06 Identities = 34/95 (35%), Positives = 48/95 (50%) Frame = -3 Query: 415 PKHSLFGRLEGLEINNMRNMKKIVHGLPPPPSLRQLRDDDGDEQHMVAVKKTSCTQTFQN 236 P S+F RLE L + +M+ ++KI HG K T T+TF Sbjct: 154 PSRSVFQRLESLTLESMKKLEKICHG-----------------------KLT--TETFHK 188 Query: 235 LQILIIRRCNGLKNLFSFGLARCLQQLKMLYVSYC 131 LQ++ + RC+ LK+LFS A CL QL+ + VS C Sbjct: 189 LQVIKVSRCHNLKDLFSLSTAMCLSQLQTIEVSCC 223