BLASTX nr result
ID: Akebia24_contig00013051
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00013051 (210 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006477434.1| PREDICTED: osmotin [Citrus sinensis] 82 1e-13 ref|XP_006440574.1| hypothetical protein CICLE_v10022104mg [Citr... 82 1e-13 ref|XP_004143988.1| PREDICTED: thaumatin-like protein-like [Cucu... 81 1e-13 ref|XP_004143926.1| PREDICTED: thaumatin-like protein-like [Cucu... 80 2e-13 ref|XP_002325077.2| hypothetical protein POPTR_0018s10490g [Popu... 79 5e-13 ref|XP_007099628.1| Pathogenesis-related thaumatin-like protein,... 79 5e-13 gb|AGC39176.1| thaumatin-like protein [Actinidia chinensis] 79 5e-13 gb|ADP69173.1| pathogenesis related protein-5 [Populus tomentosa] 79 5e-13 pdb|4BCT|A Chain A, Crystal Structure Of Kiwi-fruit Allergen Act... 78 1e-12 ref|XP_007040162.1| Osmotin 34 [Theobroma cacao] gi|508777407|gb... 78 1e-12 ref|XP_004245632.1| PREDICTED: thaumatin-like protein-like [Sola... 78 1e-12 gb|AAV34889.2| osmotin-like [Theobroma cacao] 78 1e-12 sp|P81370.2|TLP_ACTDE RecName: Full=Thaumatin-like protein; AltN... 78 1e-12 gb|ACH54108.1| osmotin isoform precursor [Piper colubrinum] 78 1e-12 gb|ABX71220.1| osmotin [Piper colubrinum] 78 1e-12 gb|ABQ42566.1| thaumatin-like protein [Actinidia deliciosa] 78 1e-12 dbj|BAO09560.1| osmotin, partial [Morus alba] 78 1e-12 gb|ACU31847.1| thaumatin-like protein [Nepenthes mirabilis] 78 1e-12 gb|ABC73397.1| thaumatin-like protein [Nepenthes gracilis] gi|25... 78 1e-12 emb|CAC22329.1| osmotin-like protein [Fagus sylvatica] 78 1e-12 >ref|XP_006477434.1| PREDICTED: osmotin [Citrus sinensis] Length = 225 Score = 81.6 bits (200), Expect = 1e-13 Identities = 34/35 (97%), Positives = 34/35 (97%) Frame = -3 Query: 208 FFKERCPDAYSYPKDDATSTFTCPGGTNYKVVFCP 104 FFKERCPDAYSYPKDDATS FTCPGGTNYKVVFCP Sbjct: 191 FFKERCPDAYSYPKDDATSVFTCPGGTNYKVVFCP 225 >ref|XP_006440574.1| hypothetical protein CICLE_v10022104mg [Citrus clementina] gi|557542836|gb|ESR53814.1| hypothetical protein CICLE_v10022104mg [Citrus clementina] Length = 225 Score = 81.6 bits (200), Expect = 1e-13 Identities = 34/35 (97%), Positives = 34/35 (97%) Frame = -3 Query: 208 FFKERCPDAYSYPKDDATSTFTCPGGTNYKVVFCP 104 FFKERCPDAYSYPKDDATS FTCPGGTNYKVVFCP Sbjct: 191 FFKERCPDAYSYPKDDATSVFTCPGGTNYKVVFCP 225 >ref|XP_004143988.1| PREDICTED: thaumatin-like protein-like [Cucumis sativus] gi|449495895|ref|XP_004159977.1| PREDICTED: thaumatin-like protein-like [Cucumis sativus] Length = 225 Score = 81.3 bits (199), Expect = 1e-13 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = -3 Query: 208 FFKERCPDAYSYPKDDATSTFTCPGGTNYKVVFCP 104 FFK+RCPDAYSYPKDDATSTFTCPGGTNY+VVFCP Sbjct: 191 FFKDRCPDAYSYPKDDATSTFTCPGGTNYRVVFCP 225 >ref|XP_004143926.1| PREDICTED: thaumatin-like protein-like [Cucumis sativus] gi|449495850|ref|XP_004159963.1| PREDICTED: thaumatin-like protein-like [Cucumis sativus] Length = 223 Score = 80.5 bits (197), Expect = 2e-13 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -3 Query: 208 FFKERCPDAYSYPKDDATSTFTCPGGTNYKVVFCP 104 FFK RCPDAYSYPKDDATSTFTCPGGTNY+VVFCP Sbjct: 189 FFKNRCPDAYSYPKDDATSTFTCPGGTNYRVVFCP 223 >ref|XP_002325077.2| hypothetical protein POPTR_0018s10490g [Populus trichocarpa] gi|550318456|gb|EEF03642.2| hypothetical protein POPTR_0018s10490g [Populus trichocarpa] Length = 189 Score = 79.3 bits (194), Expect = 5e-13 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -3 Query: 208 FFKERCPDAYSYPKDDATSTFTCPGGTNYKVVFCP 104 FFK+RCPDAYSYPKDD TSTFTCPGGTNY+VVFCP Sbjct: 155 FFKQRCPDAYSYPKDDQTSTFTCPGGTNYRVVFCP 189 >ref|XP_007099628.1| Pathogenesis-related thaumatin-like protein, putative [Theobroma cacao] gi|508728506|gb|EOY20403.1| Pathogenesis-related thaumatin-like protein, putative [Theobroma cacao] Length = 245 Score = 79.3 bits (194), Expect = 5e-13 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -3 Query: 208 FFKERCPDAYSYPKDDATSTFTCPGGTNYKVVFCP 104 FFK+RCPDAYSYPKDD TSTFTCPGGTNY+VVFCP Sbjct: 211 FFKDRCPDAYSYPKDDQTSTFTCPGGTNYRVVFCP 245 >gb|AGC39176.1| thaumatin-like protein [Actinidia chinensis] Length = 225 Score = 79.3 bits (194), Expect = 5e-13 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -3 Query: 208 FFKERCPDAYSYPKDDATSTFTCPGGTNYKVVFCP 104 FFK RCPDAYSYPKDD TSTFTCPGGTNYKVVFCP Sbjct: 191 FFKTRCPDAYSYPKDDQTSTFTCPGGTNYKVVFCP 225 >gb|ADP69173.1| pathogenesis related protein-5 [Populus tomentosa] Length = 225 Score = 79.3 bits (194), Expect = 5e-13 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -3 Query: 208 FFKERCPDAYSYPKDDATSTFTCPGGTNYKVVFCP 104 FFK+RCPDAYSYPKDD TSTFTCPGGTNY+VVFCP Sbjct: 191 FFKQRCPDAYSYPKDDQTSTFTCPGGTNYRVVFCP 225 >pdb|4BCT|A Chain A, Crystal Structure Of Kiwi-fruit Allergen Act D 2 Length = 201 Score = 78.2 bits (191), Expect = 1e-12 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -3 Query: 208 FFKERCPDAYSYPKDDATSTFTCPGGTNYKVVFCP 104 FFK+RCPDAYSYPKDD TSTFTCP GTNYKVVFCP Sbjct: 167 FFKDRCPDAYSYPKDDQTSTFTCPAGTNYKVVFCP 201 >ref|XP_007040162.1| Osmotin 34 [Theobroma cacao] gi|508777407|gb|EOY24663.1| Osmotin 34 [Theobroma cacao] Length = 224 Score = 78.2 bits (191), Expect = 1e-12 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -3 Query: 208 FFKERCPDAYSYPKDDATSTFTCPGGTNYKVVFCP 104 FFK RCPDAYSYPKDD TSTFTCPGGTNY+VVFCP Sbjct: 190 FFKTRCPDAYSYPKDDQTSTFTCPGGTNYRVVFCP 224 >ref|XP_004245632.1| PREDICTED: thaumatin-like protein-like [Solanum lycopersicum] Length = 220 Score = 78.2 bits (191), Expect = 1e-12 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -3 Query: 208 FFKERCPDAYSYPKDDATSTFTCPGGTNYKVVFCP 104 FFKERCPDAYSYPKDD TSTFTCP GTNY+VVFCP Sbjct: 186 FFKERCPDAYSYPKDDQTSTFTCPAGTNYRVVFCP 220 >gb|AAV34889.2| osmotin-like [Theobroma cacao] Length = 204 Score = 78.2 bits (191), Expect = 1e-12 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -3 Query: 208 FFKERCPDAYSYPKDDATSTFTCPGGTNYKVVFCP 104 FFK RCPDAYSYPKDD TSTFTCPGGTNY+VVFCP Sbjct: 170 FFKTRCPDAYSYPKDDQTSTFTCPGGTNYRVVFCP 204 >sp|P81370.2|TLP_ACTDE RecName: Full=Thaumatin-like protein; AltName: Allergen=Act d 2; Flags: Precursor gi|71057064|emb|CAI38795.2| thaumatin-like protein [Actinidia deliciosa] gi|441482368|gb|AGC39175.1| thaumatin-like protein [Actinidia deliciosa] Length = 225 Score = 78.2 bits (191), Expect = 1e-12 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -3 Query: 208 FFKERCPDAYSYPKDDATSTFTCPGGTNYKVVFCP 104 FFK+RCPDAYSYPKDD TSTFTCP GTNYKVVFCP Sbjct: 191 FFKDRCPDAYSYPKDDQTSTFTCPAGTNYKVVFCP 225 >gb|ACH54108.1| osmotin isoform precursor [Piper colubrinum] Length = 180 Score = 78.2 bits (191), Expect = 1e-12 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -3 Query: 208 FFKERCPDAYSYPKDDATSTFTCPGGTNYKVVFCP 104 FFK RCPDAYSYPKDD TSTFTCPGGTNY+VVFCP Sbjct: 146 FFKTRCPDAYSYPKDDPTSTFTCPGGTNYRVVFCP 180 >gb|ABX71220.1| osmotin [Piper colubrinum] Length = 230 Score = 78.2 bits (191), Expect = 1e-12 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -3 Query: 208 FFKERCPDAYSYPKDDATSTFTCPGGTNYKVVFCP 104 FFK RCPDAYSYPKDD TSTFTCPGGTNY+VVFCP Sbjct: 196 FFKTRCPDAYSYPKDDPTSTFTCPGGTNYRVVFCP 230 >gb|ABQ42566.1| thaumatin-like protein [Actinidia deliciosa] Length = 201 Score = 78.2 bits (191), Expect = 1e-12 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -3 Query: 208 FFKERCPDAYSYPKDDATSTFTCPGGTNYKVVFCP 104 FFK+RCPDAYSYPKDD TSTFTCP GTNYKVVFCP Sbjct: 167 FFKDRCPDAYSYPKDDQTSTFTCPAGTNYKVVFCP 201 >dbj|BAO09560.1| osmotin, partial [Morus alba] Length = 231 Score = 77.8 bits (190), Expect = 1e-12 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = -3 Query: 208 FFKERCPDAYSYPKDDATSTFTCPGGTNYKVVFCP 104 FFK+RCPDAYSYP+DD TSTFTCPGGTNY+VVFCP Sbjct: 181 FFKQRCPDAYSYPQDDPTSTFTCPGGTNYRVVFCP 215 >gb|ACU31847.1| thaumatin-like protein [Nepenthes mirabilis] Length = 225 Score = 77.8 bits (190), Expect = 1e-12 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -3 Query: 208 FFKERCPDAYSYPKDDATSTFTCPGGTNYKVVFCP 104 FFK CPDAYSYPKDDATST+TCPGGTNYKVVFCP Sbjct: 191 FFKNLCPDAYSYPKDDATSTYTCPGGTNYKVVFCP 225 >gb|ABC73397.1| thaumatin-like protein [Nepenthes gracilis] gi|255740175|gb|ACU31844.1| thaumatin-like protein [Nepenthes gracilis] Length = 225 Score = 77.8 bits (190), Expect = 1e-12 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -3 Query: 208 FFKERCPDAYSYPKDDATSTFTCPGGTNYKVVFCP 104 FFK CPDAYSYPKDDATST+TCPGGTNYKVVFCP Sbjct: 191 FFKNLCPDAYSYPKDDATSTYTCPGGTNYKVVFCP 225 >emb|CAC22329.1| osmotin-like protein [Fagus sylvatica] Length = 125 Score = 77.8 bits (190), Expect = 1e-12 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = -3 Query: 208 FFKERCPDAYSYPKDDATSTFTCPGGTNYKVVFCP 104 FFK+RCPDAYSYP+DD TSTFTCPGGTNY+VVFCP Sbjct: 91 FFKQRCPDAYSYPQDDPTSTFTCPGGTNYRVVFCP 125