BLASTX nr result
ID: Akebia24_contig00012461
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00012461 (336 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002306310.2| hypothetical protein POPTR_0005s07720g [Popu... 55 8e-06 ref|XP_003601953.1| Asparagine synthetase [Medicago truncatula] ... 55 8e-06 gb|ABK95431.1| unknown [Populus trichocarpa] gi|118488371|gb|ABK... 55 8e-06 >ref|XP_002306310.2| hypothetical protein POPTR_0005s07720g [Populus trichocarpa] gi|550338345|gb|EEE93306.2| hypothetical protein POPTR_0005s07720g [Populus trichocarpa] Length = 585 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 2 EGIDALEEVIYYIEIYDVTTVRVSTPMFLI 91 EGIDALEEVIY+IE YDVTTVR STPMFL+ Sbjct: 298 EGIDALEEVIYHIETYDVTTVRASTPMFLM 327 >ref|XP_003601953.1| Asparagine synthetase [Medicago truncatula] gi|355491001|gb|AES72204.1| Asparagine synthetase [Medicago truncatula] Length = 570 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 2 EGIDALEEVIYYIEIYDVTTVRVSTPMFLI 91 EGIDALEEVIY+IE YDVTTVR STPMFL+ Sbjct: 298 EGIDALEEVIYHIETYDVTTVRASTPMFLM 327 >gb|ABK95431.1| unknown [Populus trichocarpa] gi|118488371|gb|ABK96003.1| unknown [Populus trichocarpa] Length = 584 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 2 EGIDALEEVIYYIEIYDVTTVRVSTPMFLI 91 EGIDALEEVIY+IE YDVTTVR STPMFL+ Sbjct: 298 EGIDALEEVIYHIETYDVTTVRASTPMFLM 327