BLASTX nr result
ID: Akebia24_contig00012002
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00012002 (315 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007203776.1| hypothetical protein PRUPE_ppa002396mg [Prun... 56 6e-06 gb|ABV32544.1| alpha-L-arabinofuranosidase protein [Prunus persica] 56 6e-06 >ref|XP_007203776.1| hypothetical protein PRUPE_ppa002396mg [Prunus persica] gi|462399307|gb|EMJ04975.1| hypothetical protein PRUPE_ppa002396mg [Prunus persica] Length = 677 Score = 55.8 bits (133), Expect = 6e-06 Identities = 31/70 (44%), Positives = 34/70 (48%) Frame = +1 Query: 1 SSRPLDHLVDLYDYHVRNRNINTNTSCMQVKGSGGHNIV*LSNYL*IYTSAKNLFSMTHQ 180 SSR LDH DLYD+HV YT AKN+FSM HQ Sbjct: 418 SSRKLDHPADLYDFHV-------------------------------YTDAKNMFSMAHQ 446 Query: 181 FDHTSRTGPK 210 FDHTSR+GPK Sbjct: 447 FDHTSRSGPK 456 >gb|ABV32544.1| alpha-L-arabinofuranosidase protein [Prunus persica] Length = 677 Score = 55.8 bits (133), Expect = 6e-06 Identities = 31/70 (44%), Positives = 34/70 (48%) Frame = +1 Query: 1 SSRPLDHLVDLYDYHVRNRNINTNTSCMQVKGSGGHNIV*LSNYL*IYTSAKNLFSMTHQ 180 SSR LDH DLYD+HV YT AKN+FSM HQ Sbjct: 418 SSRKLDHPADLYDFHV-------------------------------YTDAKNMFSMAHQ 446 Query: 181 FDHTSRTGPK 210 FDHTSR+GPK Sbjct: 447 FDHTSRSGPK 456