BLASTX nr result
ID: Akebia24_contig00010996
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00010996 (280 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB98011.1| SWI/SNF complex component SNF12-like protein [Mor... 63 4e-08 >gb|EXB98011.1| SWI/SNF complex component SNF12-like protein [Morus notabilis] Length = 544 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/55 (50%), Positives = 36/55 (65%) Frame = +1 Query: 64 MSANSNNPMRNIGGLSPLDNAGMVSSSLPINHPSHLHPQSQTQTPDGSHFQGQFQ 228 MS N+NN ++N+G N+GMV S+P+NH HL Q+Q QT GSHF G FQ Sbjct: 1 MSMNNNNQVKNVGAPPHFGNSGMVPQSMPLNHQPHLLSQAQPQTQSGSHFPGHFQ 55