BLASTX nr result
ID: Akebia24_contig00010879
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00010879 (229 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC30749.1| hypothetical protein L484_027924 [Morus notabilis] 56 6e-06 gb|EXB65283.1| hypothetical protein L484_025362 [Morus notabilis] 56 6e-06 ref|XP_006286954.1| hypothetical protein CARUB_v10000101mg [Caps... 56 6e-06 ref|XP_006286953.1| hypothetical protein CARUB_v10000101mg [Caps... 56 6e-06 ref|NP_196230.2| Importin-beta, N-terminal domain-containing pro... 56 6e-06 ref|NP_001190235.1| Importin-beta, N-terminal domain-containing ... 56 6e-06 >gb|EXC30749.1| hypothetical protein L484_027924 [Morus notabilis] Length = 785 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -1 Query: 85 MESLAQLEALCERLYNSQNSVERAHAE 5 MESLAQLEALCERLYNSQNS+ERAHAE Sbjct: 1 MESLAQLEALCERLYNSQNSIERAHAE 27 >gb|EXB65283.1| hypothetical protein L484_025362 [Morus notabilis] Length = 88 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -1 Query: 85 MESLAQLEALCERLYNSQNSVERAHAE 5 MESLAQLEALCERLYNSQNS+ERAHAE Sbjct: 1 MESLAQLEALCERLYNSQNSIERAHAE 27 >ref|XP_006286954.1| hypothetical protein CARUB_v10000101mg [Capsella rubella] gi|482555660|gb|EOA19852.1| hypothetical protein CARUB_v10000101mg [Capsella rubella] Length = 1063 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -1 Query: 94 LSPMESLAQLEALCERLYNSQNSVERAHAES 2 L PMESLAQLEA+CERLYNSQ+S ERAHAE+ Sbjct: 6 LLPMESLAQLEAMCERLYNSQDSAERAHAEN 36 >ref|XP_006286953.1| hypothetical protein CARUB_v10000101mg [Capsella rubella] gi|482555659|gb|EOA19851.1| hypothetical protein CARUB_v10000101mg [Capsella rubella] Length = 1062 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -1 Query: 94 LSPMESLAQLEALCERLYNSQNSVERAHAES 2 L PMESLAQLEA+CERLYNSQ+S ERAHAE+ Sbjct: 6 LLPMESLAQLEAMCERLYNSQDSAERAHAEN 36 >ref|NP_196230.2| Importin-beta, N-terminal domain-containing protein [Arabidopsis thaliana] gi|332003586|gb|AED90969.1| Importin-beta, N-terminal domain-containing protein [Arabidopsis thaliana] Length = 1066 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -1 Query: 94 LSPMESLAQLEALCERLYNSQNSVERAHAES 2 L PMESLAQLEA+CERLYNSQ+S ERAHAE+ Sbjct: 6 LLPMESLAQLEAMCERLYNSQDSAERAHAEN 36 >ref|NP_001190235.1| Importin-beta, N-terminal domain-containing protein [Arabidopsis thaliana] gi|332003587|gb|AED90970.1| Importin-beta, N-terminal domain-containing protein [Arabidopsis thaliana] Length = 1059 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -1 Query: 94 LSPMESLAQLEALCERLYNSQNSVERAHAES 2 L PMESLAQLEA+CERLYNSQ+S ERAHAE+ Sbjct: 6 LLPMESLAQLEAMCERLYNSQDSAERAHAEN 36