BLASTX nr result
ID: Akebia24_contig00010754
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00010754 (239 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN75362.1| hypothetical protein VITISV_033265 [Vitis vinifera] 90 3e-16 gb|AFN88207.1| integrase core domain containing protein [Phaseol... 89 5e-16 emb|CAN77529.1| hypothetical protein VITISV_041425 [Vitis vinifera] 88 1e-15 emb|CAN63507.1| hypothetical protein VITISV_029435 [Vitis vinifera] 86 4e-15 emb|CAN63081.1| hypothetical protein VITISV_016842 [Vitis vinifera] 86 5e-15 emb|CAN61179.1| hypothetical protein VITISV_032292 [Vitis vinifera] 86 5e-15 emb|CAN71553.1| hypothetical protein VITISV_034738 [Vitis vinifera] 86 7e-15 emb|CAN71185.1| hypothetical protein VITISV_014270 [Vitis vinifera] 85 9e-15 emb|CAN67119.1| hypothetical protein VITISV_017483 [Vitis vinifera] 85 1e-14 gb|AAD43604.1|AC005698_3 T3P18.3 [Arabidopsis thaliana] 84 2e-14 emb|CAC37623.1| copia-like polyprotein [Arabidopsis thaliana] 84 2e-14 emb|CAN84135.1| hypothetical protein VITISV_000113 [Vitis vinifera] 84 2e-14 emb|CAN64827.1| hypothetical protein VITISV_030308 [Vitis vinifera] 84 2e-14 emb|CAN71246.1| hypothetical protein VITISV_011986 [Vitis vinifera] 84 2e-14 emb|CAN81139.1| hypothetical protein VITISV_018760 [Vitis vinifera] 84 2e-14 emb|CAN78616.1| hypothetical protein VITISV_003658 [Vitis vinifera] 84 2e-14 emb|CAN80753.1| hypothetical protein VITISV_003323 [Vitis vinifera] 84 2e-14 emb|CAN82064.1| hypothetical protein VITISV_022772 [Vitis vinifera] 84 2e-14 emb|CAN80547.1| hypothetical protein VITISV_010898 [Vitis vinifera] 84 2e-14 emb|CAN70689.1| hypothetical protein VITISV_012155 [Vitis vinifera] 84 2e-14 >emb|CAN75362.1| hypothetical protein VITISV_033265 [Vitis vinifera] Length = 710 Score = 90.1 bits (222), Expect = 3e-16 Identities = 38/68 (55%), Positives = 55/68 (80%) Frame = -1 Query: 224 HLLCRLKKALYGLKQSPRAWFDKFSSVVLQYGFQDSTSDHSVFTRHSTSDTIILTVHMDD 45 HL+C+LK+A+YGLK PRAWFDKF+ VV GF+ S +DHSVF RHS+S ++L V++DD Sbjct: 378 HLVCKLKQAIYGLKXXPRAWFDKFNHVVFAXGFRRSQADHSVFVRHSSSGIVVLIVYVDD 437 Query: 44 IIVTSSEL 21 I+++ S++ Sbjct: 438 ILLSGSDV 445 >gb|AFN88207.1| integrase core domain containing protein [Phaseolus vulgaris] Length = 1387 Score = 89.4 bits (220), Expect = 5e-16 Identities = 41/66 (62%), Positives = 53/66 (80%) Frame = -1 Query: 221 LLCRLKKALYGLKQSPRAWFDKFSSVVLQYGFQDSTSDHSVFTRHSTSDTIILTVHMDDI 42 L+CRL+K+LYGLKQSPRAWF KFS+VV Q+G S +DHSVF RHS+ I L V++DDI Sbjct: 1015 LVCRLRKSLYGLKQSPRAWFGKFSNVVQQFGMTRSEADHSVFYRHSSVGCIYLVVYVDDI 1074 Query: 41 IVTSSE 24 ++T S+ Sbjct: 1075 VLTGSD 1080 >emb|CAN77529.1| hypothetical protein VITISV_041425 [Vitis vinifera] Length = 1047 Score = 87.8 bits (216), Expect = 1e-15 Identities = 39/66 (59%), Positives = 51/66 (77%) Frame = -1 Query: 224 HLLCRLKKALYGLKQSPRAWFDKFSSVVLQYGFQDSTSDHSVFTRHSTSDTIILTVHMDD 45 H +C+L KALYGLKQ+PRAWF K ++ YGFQ S +D S+F H+TSD +IL V++DD Sbjct: 889 HYVCKLHKALYGLKQAPRAWFQKLRVALVDYGFQSSQADTSLFIHHTTSDILILLVYVDD 948 Query: 44 IIVTSS 27 I+VTSS Sbjct: 949 ILVTSS 954 >emb|CAN63507.1| hypothetical protein VITISV_029435 [Vitis vinifera] Length = 1211 Score = 86.3 bits (212), Expect = 4e-15 Identities = 40/67 (59%), Positives = 53/67 (79%), Gaps = 1/67 (1%) Frame = -1 Query: 221 LLCRLKKALYGLKQSPRAWFDKFSSVVLQYGFQDSTSDHSVFTRH-STSDTIILTVHMDD 45 L+CRL+++LYGLKQSPRAWFD+FSSVV ++G ST+DHSVF H S I L V++DD Sbjct: 838 LVCRLRRSLYGLKQSPRAWFDRFSSVVQEFGMLRSTADHSVFYHHNSLEQCIYLVVYVDD 897 Query: 44 IIVTSSE 24 I++T S+ Sbjct: 898 IVITGSD 904 >emb|CAN63081.1| hypothetical protein VITISV_016842 [Vitis vinifera] Length = 1179 Score = 85.9 bits (211), Expect = 5e-15 Identities = 41/72 (56%), Positives = 56/72 (77%), Gaps = 1/72 (1%) Frame = -1 Query: 236 EKKEHLLCRLKKALYGLKQSPRAWFDKFSSVVLQYGFQDSTSDHSVFTRHSTS-DTIILT 60 E + L+CRL+++LYGLKQSPRAWF +FSSVV ++G ST+DHSVF H++S I L Sbjct: 887 EGESGLVCRLRRSLYGLKQSPRAWFSRFSSVVQEFGMFRSTADHSVFYHHNSSGQCIYLV 946 Query: 59 VHMDDIIVTSSE 24 V++DDII+T S+ Sbjct: 947 VYVDDIIITGSD 958 >emb|CAN61179.1| hypothetical protein VITISV_032292 [Vitis vinifera] Length = 1237 Score = 85.9 bits (211), Expect = 5e-15 Identities = 40/67 (59%), Positives = 53/67 (79%), Gaps = 1/67 (1%) Frame = -1 Query: 221 LLCRLKKALYGLKQSPRAWFDKFSSVVLQYGFQDSTSDHSVFTRH-STSDTIILTVHMDD 45 L+CRL+++LYGLKQSPRAWF++FSSVV ++G ST+DHSVF H S I L V+MDD Sbjct: 898 LVCRLRRSLYGLKQSPRAWFNRFSSVVQEFGMLRSTADHSVFYHHNSLGQCIYLVVYMDD 957 Query: 44 IIVTSSE 24 I++T S+ Sbjct: 958 IVITGSD 964 >emb|CAN71553.1| hypothetical protein VITISV_034738 [Vitis vinifera] Length = 1312 Score = 85.5 bits (210), Expect = 7e-15 Identities = 40/64 (62%), Positives = 51/64 (79%) Frame = -1 Query: 218 LCRLKKALYGLKQSPRAWFDKFSSVVLQYGFQDSTSDHSVFTRHSTSDTIILTVHMDDII 39 +CRL+KALYGLKQ+PRAWF K SS +LQ GFQ S +D S+F HS SD IIL +++DDI+ Sbjct: 938 VCRLQKALYGLKQAPRAWFHKLSSFLLQIGFQCSRADASLFYFHSASDIIILLIYVDDIL 997 Query: 38 VTSS 27 +T S Sbjct: 998 ITGS 1001 >emb|CAN71185.1| hypothetical protein VITISV_014270 [Vitis vinifera] Length = 1024 Score = 85.1 bits (209), Expect = 9e-15 Identities = 40/67 (59%), Positives = 52/67 (77%), Gaps = 1/67 (1%) Frame = -1 Query: 221 LLCRLKKALYGLKQSPRAWFDKFSSVVLQYGFQDSTSDHSVFTRH-STSDTIILTVHMDD 45 L+CRL+++LYGLKQSPRAWF +FSSVV ++G STSDHSVF H S I L V++DD Sbjct: 693 LVCRLRRSLYGLKQSPRAWFGRFSSVVQEFGMLXSTSDHSVFYHHNSLGQCIYLVVYVDD 752 Query: 44 IIVTSSE 24 I++T S+ Sbjct: 753 IVITGSD 759 >emb|CAN67119.1| hypothetical protein VITISV_017483 [Vitis vinifera] Length = 1970 Score = 84.7 bits (208), Expect = 1e-14 Identities = 40/72 (55%), Positives = 54/72 (75%), Gaps = 1/72 (1%) Frame = -1 Query: 236 EKKEHLLCRLKKALYGLKQSPRAWFDKFSSVVLQYGFQDSTSDHSVFTRH-STSDTIILT 60 E + L+CRL+++LYGLKQSPRAWF +FSSVV ++G ST+DHSVF H S I L Sbjct: 915 EGESGLVCRLRRSLYGLKQSPRAWFSRFSSVVQEFGMLRSTADHSVFYHHNSLGQCIYLV 974 Query: 59 VHMDDIIVTSSE 24 V++DDI++T S+ Sbjct: 975 VYVDDIVITGSD 986 >gb|AAD43604.1|AC005698_3 T3P18.3 [Arabidopsis thaliana] Length = 1309 Score = 84.3 bits (207), Expect = 2e-14 Identities = 38/71 (53%), Positives = 54/71 (76%) Frame = -1 Query: 230 KEHLLCRLKKALYGLKQSPRAWFDKFSSVVLQYGFQDSTSDHSVFTRHSTSDTIILTVHM 51 K + +CRL KALYGLKQ+PRAWFD FS+ +L +GF+ STSD S+F H ++IL +++ Sbjct: 856 KPNHVCRLTKALYGLKQAPRAWFDTFSNFLLDFGFECSTSDPSLFVCHQNGQSLILLLYV 915 Query: 50 DDIIVTSSELL 18 DDI++T S+ L Sbjct: 916 DDILLTGSDQL 926 >emb|CAC37623.1| copia-like polyprotein [Arabidopsis thaliana] Length = 1466 Score = 84.3 bits (207), Expect = 2e-14 Identities = 38/71 (53%), Positives = 54/71 (76%) Frame = -1 Query: 230 KEHLLCRLKKALYGLKQSPRAWFDKFSSVVLQYGFQDSTSDHSVFTRHSTSDTIILTVHM 51 K + +CRL KALYGLKQ+PRAWFD FS+ +L +GF+ STSD S+F H ++IL +++ Sbjct: 1013 KPNHVCRLTKALYGLKQAPRAWFDTFSNFLLDFGFECSTSDPSLFVCHQNGQSLILLLYV 1072 Query: 50 DDIIVTSSELL 18 DDI++T S+ L Sbjct: 1073 DDILLTGSDQL 1083 >emb|CAN84135.1| hypothetical protein VITISV_000113 [Vitis vinifera] Length = 1323 Score = 84.3 bits (207), Expect = 2e-14 Identities = 39/67 (58%), Positives = 52/67 (77%), Gaps = 1/67 (1%) Frame = -1 Query: 221 LLCRLKKALYGLKQSPRAWFDKFSSVVLQYGFQDSTSDHSVFTRH-STSDTIILTVHMDD 45 L+CRL+++LYGLKQSPRAWF +FSSVV ++G ST+DHSVF H S I L V++DD Sbjct: 950 LVCRLRRSLYGLKQSPRAWFSRFSSVVQEFGMLXSTADHSVFYHHNSLGQCIYLVVYVDD 1009 Query: 44 IIVTSSE 24 I++T S+ Sbjct: 1010 IVITGSD 1016 >emb|CAN64827.1| hypothetical protein VITISV_030308 [Vitis vinifera] Length = 1096 Score = 84.3 bits (207), Expect = 2e-14 Identities = 39/67 (58%), Positives = 52/67 (77%), Gaps = 1/67 (1%) Frame = -1 Query: 221 LLCRLKKALYGLKQSPRAWFDKFSSVVLQYGFQDSTSDHSVFTRH-STSDTIILTVHMDD 45 L+CRL+++LYGLKQSPRAWF +FSSVV ++G ST+DHSVF H S I L V++DD Sbjct: 866 LVCRLRRSLYGLKQSPRAWFSRFSSVVQEFGMLHSTADHSVFYHHNSLGQCIYLVVYVDD 925 Query: 44 IIVTSSE 24 I++T S+ Sbjct: 926 IVITGSD 932 >emb|CAN71246.1| hypothetical protein VITISV_011986 [Vitis vinifera] Length = 937 Score = 84.3 bits (207), Expect = 2e-14 Identities = 39/67 (58%), Positives = 52/67 (77%), Gaps = 1/67 (1%) Frame = -1 Query: 221 LLCRLKKALYGLKQSPRAWFDKFSSVVLQYGFQDSTSDHSVFTRH-STSDTIILTVHMDD 45 L+CRL+++LYGLKQSPRAWF +FSSVV ++G ST+DHSVF H S I L V++DD Sbjct: 564 LVCRLRRSLYGLKQSPRAWFSRFSSVVQEFGMXRSTADHSVFYHHNSLGQCIYLVVYVDD 623 Query: 44 IIVTSSE 24 I++T S+ Sbjct: 624 IVITGSD 630 >emb|CAN81139.1| hypothetical protein VITISV_018760 [Vitis vinifera] Length = 1403 Score = 84.0 bits (206), Expect = 2e-14 Identities = 39/67 (58%), Positives = 52/67 (77%), Gaps = 1/67 (1%) Frame = -1 Query: 221 LLCRLKKALYGLKQSPRAWFDKFSSVVLQYGFQDSTSDHSVFTRH-STSDTIILTVHMDD 45 L+CRL+++LYGLKQSPRAWF +FSSVV ++G ST+DHSVF H S I L V++DD Sbjct: 1091 LVCRLRRSLYGLKQSPRAWFSRFSSVVQEFGMLRSTADHSVFYHHNSLGQCIYLVVYVDD 1150 Query: 44 IIVTSSE 24 I++T S+ Sbjct: 1151 IVITGSD 1157 >emb|CAN78616.1| hypothetical protein VITISV_003658 [Vitis vinifera] Length = 2172 Score = 84.0 bits (206), Expect = 2e-14 Identities = 39/67 (58%), Positives = 52/67 (77%), Gaps = 1/67 (1%) Frame = -1 Query: 221 LLCRLKKALYGLKQSPRAWFDKFSSVVLQYGFQDSTSDHSVFTRH-STSDTIILTVHMDD 45 L+CRL+++LYGLKQSPRAWF +FSSVV ++G ST+DHSVF H S I L V++DD Sbjct: 1637 LVCRLRRSLYGLKQSPRAWFSRFSSVVQEFGMLRSTADHSVFYHHNSLGQCIYLVVYVDD 1696 Query: 44 IIVTSSE 24 I++T S+ Sbjct: 1697 IVITGSD 1703 >emb|CAN80753.1| hypothetical protein VITISV_003323 [Vitis vinifera] Length = 1304 Score = 84.0 bits (206), Expect = 2e-14 Identities = 39/67 (58%), Positives = 52/67 (77%), Gaps = 1/67 (1%) Frame = -1 Query: 221 LLCRLKKALYGLKQSPRAWFDKFSSVVLQYGFQDSTSDHSVFTRH-STSDTIILTVHMDD 45 L+CRL+++LYGLKQSPRAWF +FSSVV ++G ST+DHSVF H S I L V++DD Sbjct: 947 LVCRLRRSLYGLKQSPRAWFSRFSSVVQEFGMLRSTADHSVFYHHNSLGQCIYLVVYVDD 1006 Query: 44 IIVTSSE 24 I++T S+ Sbjct: 1007 IVITGSD 1013 >emb|CAN82064.1| hypothetical protein VITISV_022772 [Vitis vinifera] Length = 1224 Score = 84.0 bits (206), Expect = 2e-14 Identities = 39/67 (58%), Positives = 52/67 (77%), Gaps = 1/67 (1%) Frame = -1 Query: 221 LLCRLKKALYGLKQSPRAWFDKFSSVVLQYGFQDSTSDHSVFTRH-STSDTIILTVHMDD 45 L+CRL+++LYGLKQSPRAWF +FSSVV ++G ST+DHSVF H S I L V++DD Sbjct: 893 LVCRLRRSLYGLKQSPRAWFSRFSSVVQEFGMLRSTADHSVFYHHNSLGQCIYLVVYVDD 952 Query: 44 IIVTSSE 24 I++T S+ Sbjct: 953 IVITGSD 959 >emb|CAN80547.1| hypothetical protein VITISV_010898 [Vitis vinifera] Length = 1181 Score = 84.0 bits (206), Expect = 2e-14 Identities = 39/67 (58%), Positives = 52/67 (77%), Gaps = 1/67 (1%) Frame = -1 Query: 221 LLCRLKKALYGLKQSPRAWFDKFSSVVLQYGFQDSTSDHSVFTRH-STSDTIILTVHMDD 45 L+CRL+++LYGLKQSPRAWF +FSSVV ++G ST+DHSVF H S I L V++DD Sbjct: 833 LVCRLRRSLYGLKQSPRAWFSRFSSVVQEFGMLRSTADHSVFYHHNSLGQCIYLVVYVDD 892 Query: 44 IIVTSSE 24 I++T S+ Sbjct: 893 IVITGSD 899 >emb|CAN70689.1| hypothetical protein VITISV_012155 [Vitis vinifera] Length = 1199 Score = 84.0 bits (206), Expect = 2e-14 Identities = 39/67 (58%), Positives = 52/67 (77%), Gaps = 1/67 (1%) Frame = -1 Query: 221 LLCRLKKALYGLKQSPRAWFDKFSSVVLQYGFQDSTSDHSVFTRH-STSDTIILTVHMDD 45 L+CRL+++LYGLKQSPRAWF +FSSVV ++G ST+DHSVF H S I L V++DD Sbjct: 444 LVCRLRRSLYGLKQSPRAWFSRFSSVVQEFGMLRSTADHSVFYHHNSLGQCIYLVVYVDD 503 Query: 44 IIVTSSE 24 I++T S+ Sbjct: 504 IVITGSD 510