BLASTX nr result
ID: Akebia24_contig00010724
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00010724 (471 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002409557.1| hypothetical protein IscW_ISCW002486 [Ixodes... 56 6e-06 >ref|XP_002409557.1| hypothetical protein IscW_ISCW002486 [Ixodes scapularis] gi|215494588|gb|EEC04229.1| hypothetical protein IscW_ISCW002486 [Ixodes scapularis] Length = 105 Score = 55.8 bits (133), Expect = 6e-06 Identities = 19/44 (43%), Positives = 24/44 (54%) Frame = -1 Query: 351 VQGMYSCWREGCCLYSCWHKGCYLYSCLREGCYLYSCWREGCYL 220 V G SCW GCC+ CW +GC + C GC + W GC+L Sbjct: 61 VAGFASCWLRGCCVLGCWIRGCRISDCWARGCSVAGWWMRGCFL 104