BLASTX nr result
ID: Akebia24_contig00010494
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00010494 (417 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007032594.1| Pentatricopeptide repeat (PPR) superfamily p... 169 3e-40 ref|XP_002283796.1| PREDICTED: pentatricopeptide repeat-containi... 169 3e-40 emb|CBI22243.3| unnamed protein product [Vitis vinifera] 167 2e-39 ref|XP_004170804.1| PREDICTED: pentatricopeptide repeat-containi... 164 1e-38 ref|XP_004141574.1| PREDICTED: pentatricopeptide repeat-containi... 164 1e-38 ref|XP_007215675.1| hypothetical protein PRUPE_ppa003946mg [Prun... 163 3e-38 ref|XP_006338776.1| PREDICTED: pentatricopeptide repeat-containi... 162 3e-38 ref|XP_004232214.1| PREDICTED: pentatricopeptide repeat-containi... 158 7e-37 ref|XP_002324070.1| pentatricopeptide repeat-containing family p... 153 3e-35 gb|EXB31944.1| hypothetical protein L484_013576 [Morus notabilis] 151 1e-34 ref|XP_004306131.1| PREDICTED: pentatricopeptide repeat-containi... 151 1e-34 ref|XP_006431200.1| hypothetical protein CICLE_v10011436mg [Citr... 149 5e-34 gb|EYU34053.1| hypothetical protein MIMGU_mgv1a004068mg [Mimulus... 144 1e-32 ref|XP_006482626.1| PREDICTED: pentatricopeptide repeat-containi... 142 5e-32 ref|XP_006400050.1| hypothetical protein EUTSA_v10015396mg [Eutr... 142 6e-32 ref|XP_002873718.1| pentatricopeptide repeat-containing protein ... 139 3e-31 ref|XP_006287429.1| hypothetical protein CARUB_v10000633mg [Caps... 137 1e-30 ref|NP_197034.2| pentatricopeptide repeat-containing protein [Ar... 136 3e-30 emb|CAB89340.1| putative protein [Arabidopsis thaliana] 136 3e-30 ref|XP_003551738.1| PREDICTED: pentatricopeptide repeat-containi... 136 3e-30 >ref|XP_007032594.1| Pentatricopeptide repeat (PPR) superfamily protein, putative [Theobroma cacao] gi|508711623|gb|EOY03520.1| Pentatricopeptide repeat (PPR) superfamily protein, putative [Theobroma cacao] Length = 549 Score = 169 bits (429), Expect = 3e-40 Identities = 79/111 (71%), Positives = 96/111 (86%) Frame = +2 Query: 2 AGLLNEAFEFVETMEIEPNSIIWRTLLGACRIQGNVELGKHTNERLLSMRWDHSGDYVLL 181 AG L+EAF+ +++MEIEPN+IIWRTLLGACRI GNVELG+ NERLL MR + SGDYVLL Sbjct: 429 AGQLDEAFKLIDSMEIEPNAIIWRTLLGACRIHGNVELGRRANERLLKMRREQSGDYVLL 488 Query: 182 ANIHASKGEWDGAERVRRLMDDRGVWKKPGCSLIDSAR*ELMHFLFDSKSK 334 +NI+ASKGEWDG E+VR++MDD GV K+PGCSL+++ LMHFLFDSKSK Sbjct: 489 SNIYASKGEWDGVEKVRKMMDDSGVTKEPGCSLLEAEEKVLMHFLFDSKSK 539 >ref|XP_002283796.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15300-like [Vitis vinifera] Length = 550 Score = 169 bits (429), Expect = 3e-40 Identities = 81/119 (68%), Positives = 97/119 (81%) Frame = +2 Query: 2 AGLLNEAFEFVETMEIEPNSIIWRTLLGACRIQGNVELGKHTNERLLSMRWDHSGDYVLL 181 AGLLNEAF+F++TM+IEPN+I+WRTLLGACRI GNVELG+ N +LL MR D SGDYVLL Sbjct: 427 AGLLNEAFDFIDTMKIEPNAIVWRTLLGACRIHGNVELGRRANMQLLKMRHDESGDYVLL 486 Query: 182 ANIHASKGEWDGAERVRRLMDDRGVWKKPGCSLIDSAR*ELMHFLFDSKSKF*VQKTML 358 +NI+AS+GEWDG E+VR+LMDD GV K+ GCSLI+ LMHFLFDSK K +K L Sbjct: 487 SNIYASRGEWDGVEKVRKLMDDSGVRKEAGCSLIEGDNKALMHFLFDSKPKLNSRKPFL 545 >emb|CBI22243.3| unnamed protein product [Vitis vinifera] Length = 526 Score = 167 bits (422), Expect = 2e-39 Identities = 78/109 (71%), Positives = 93/109 (85%) Frame = +2 Query: 2 AGLLNEAFEFVETMEIEPNSIIWRTLLGACRIQGNVELGKHTNERLLSMRWDHSGDYVLL 181 AGLLNEAF+F++TM+IEPN+I+WRTLLGACRI GNVELG+ N +LL MR D SGDYVLL Sbjct: 392 AGLLNEAFDFIDTMKIEPNAIVWRTLLGACRIHGNVELGRRANMQLLKMRHDESGDYVLL 451 Query: 182 ANIHASKGEWDGAERVRRLMDDRGVWKKPGCSLIDSAR*ELMHFLFDSK 328 +NI+AS+GEWDG E+VR+LMDD GV K+ GCSLI+ LMHFLFDSK Sbjct: 452 SNIYASRGEWDGVEKVRKLMDDSGVRKEAGCSLIEGDNKALMHFLFDSK 500 >ref|XP_004170804.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15300-like, partial [Cucumis sativus] Length = 315 Score = 164 bits (415), Expect = 1e-38 Identities = 80/112 (71%), Positives = 94/112 (83%) Frame = +2 Query: 2 AGLLNEAFEFVETMEIEPNSIIWRTLLGACRIQGNVELGKHTNERLLSMRWDHSGDYVLL 181 AGLL EAF+F++TMEIEPN+IIWRTLLGACR+ G+VELG+ NE+LL MR D SGDYVLL Sbjct: 200 AGLLIEAFDFIDTMEIEPNAIIWRTLLGACRVHGDVELGRRANEQLLKMRKDESGDYVLL 259 Query: 182 ANIHASKGEWDGAERVRRLMDDRGVWKKPGCSLIDSAR*ELMHFLFDSKSKF 337 +NI+AS+GEWDG ++VR+LMDD GV KK G SLIDS LMHFLFDSK F Sbjct: 260 SNIYASQGEWDGVQKVRKLMDDGGVKKKVGHSLIDSDNSFLMHFLFDSKPNF 311 >ref|XP_004141574.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15300-like [Cucumis sativus] Length = 542 Score = 164 bits (415), Expect = 1e-38 Identities = 80/112 (71%), Positives = 94/112 (83%) Frame = +2 Query: 2 AGLLNEAFEFVETMEIEPNSIIWRTLLGACRIQGNVELGKHTNERLLSMRWDHSGDYVLL 181 AGLL EAF+F++TMEIEPN+IIWRTLLGACR+ G+VELG+ NE+LL MR D SGDYVLL Sbjct: 427 AGLLIEAFDFIDTMEIEPNAIIWRTLLGACRVHGDVELGRRANEQLLKMRKDESGDYVLL 486 Query: 182 ANIHASKGEWDGAERVRRLMDDRGVWKKPGCSLIDSAR*ELMHFLFDSKSKF 337 +NI+AS+GEWDG ++VR+LMDD GV KK G SLIDS LMHFLFDSK F Sbjct: 487 SNIYASQGEWDGVQKVRKLMDDGGVKKKVGHSLIDSDNSFLMHFLFDSKPNF 538 >ref|XP_007215675.1| hypothetical protein PRUPE_ppa003946mg [Prunus persica] gi|462411825|gb|EMJ16874.1| hypothetical protein PRUPE_ppa003946mg [Prunus persica] Length = 539 Score = 163 bits (412), Expect = 3e-38 Identities = 77/111 (69%), Positives = 93/111 (83%) Frame = +2 Query: 2 AGLLNEAFEFVETMEIEPNSIIWRTLLGACRIQGNVELGKHTNERLLSMRWDHSGDYVLL 181 AGLL+EAFEF+E MEIEPN+I+WRTLLGACR+ GNVELG+ NERLL MR D SGD+VLL Sbjct: 427 AGLLDEAFEFIEKMEIEPNAIVWRTLLGACRVHGNVELGRRANERLLEMRRDESGDFVLL 486 Query: 182 ANIHASKGEWDGAERVRRLMDDRGVWKKPGCSLIDSAR*ELMHFLFDSKSK 334 +NI+AS+GEW G E VR+LMDD GV K+PG SLI++ +LMHFLFD + K Sbjct: 487 SNIYASRGEWRGVEEVRKLMDDSGVKKEPGYSLIETDNSDLMHFLFDYRPK 537 >ref|XP_006338776.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15300-like [Solanum tuberosum] Length = 539 Score = 162 bits (411), Expect = 3e-38 Identities = 74/111 (66%), Positives = 94/111 (84%) Frame = +2 Query: 2 AGLLNEAFEFVETMEIEPNSIIWRTLLGACRIQGNVELGKHTNERLLSMRWDHSGDYVLL 181 AGLLNEAFEF+ TMEI+PN+IIWRTLLGAC++ NVELG++ NE+LL + + SGDYVLL Sbjct: 427 AGLLNEAFEFINTMEIKPNAIIWRTLLGACKVHSNVELGRYANEQLLKLGREDSGDYVLL 486 Query: 182 ANIHASKGEWDGAERVRRLMDDRGVWKKPGCSLIDSAR*ELMHFLFDSKSK 334 +NI+AS+ EWDG ERVR+LMDD GVWK+PGC+LI++ +L +F FDSK K Sbjct: 487 SNIYASRDEWDGVERVRKLMDDNGVWKEPGCTLIEADDYDLKNFCFDSKRK 537 >ref|XP_004232214.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15300-like [Solanum lycopersicum] Length = 539 Score = 158 bits (400), Expect = 7e-37 Identities = 71/111 (63%), Positives = 94/111 (84%) Frame = +2 Query: 2 AGLLNEAFEFVETMEIEPNSIIWRTLLGACRIQGNVELGKHTNERLLSMRWDHSGDYVLL 181 AGLLNEAFEF+ TM+I+PN+IIWRTLLGAC++ NV+LG++ N++LL + + SGDYVLL Sbjct: 427 AGLLNEAFEFINTMDIKPNAIIWRTLLGACKVHSNVKLGRYANKQLLKLGREDSGDYVLL 486 Query: 182 ANIHASKGEWDGAERVRRLMDDRGVWKKPGCSLIDSAR*ELMHFLFDSKSK 334 +NI+AS+ EWDG ERVR+LMDD GVWK+PGC+LI++ +L +F FDSK K Sbjct: 487 SNIYASRDEWDGVERVRKLMDDNGVWKEPGCTLIEADDYDLKNFYFDSKCK 537 >ref|XP_002324070.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|222867072|gb|EEF04203.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 546 Score = 153 bits (386), Expect = 3e-35 Identities = 76/111 (68%), Positives = 89/111 (80%) Frame = +2 Query: 2 AGLLNEAFEFVETMEIEPNSIIWRTLLGACRIQGNVELGKHTNERLLSMRWDHSGDYVLL 181 AGLL+EAFE + MEIEPN+IIWRTLLGACR+ GNVELG+ NERLL +R D SGDYVLL Sbjct: 428 AGLLSEAFELIAKMEIEPNAIIWRTLLGACRVHGNVELGRLANERLLKLRRDESGDYVLL 487 Query: 182 ANIHASKGEWDGAERVRRLMDDRGVWKKPGCSLIDSAR*ELMHFLFDSKSK 334 +NI+AS GEWDGAE VR+LMDD GV K+ G SLI++ +M FLFD K K Sbjct: 488 SNIYASAGEWDGAEEVRKLMDDGGVRKEAGRSLIEADDRAVMQFLFDPKPK 538 >gb|EXB31944.1| hypothetical protein L484_013576 [Morus notabilis] Length = 512 Score = 151 bits (381), Expect = 1e-34 Identities = 73/111 (65%), Positives = 88/111 (79%) Frame = +2 Query: 2 AGLLNEAFEFVETMEIEPNSIIWRTLLGACRIQGNVELGKHTNERLLSMRWDHSGDYVLL 181 AGLLNEAF+F+ETMEIE N I+WRTLLGACRI GNVEL K ++ LL MR + SGDYVLL Sbjct: 392 AGLLNEAFDFMETMEIESNGIVWRTLLGACRIHGNVELAKRASDELLRMRTNESGDYVLL 451 Query: 182 ANIHASKGEWDGAERVRRLMDDRGVWKKPGCSLIDSAR*ELMHFLFDSKSK 334 +NI+AS+GEW+GAE+VR MD GV K+ GCSLI++ + FLFD KSK Sbjct: 452 SNIYASQGEWNGAEKVRESMDKSGVMKEAGCSLIEANNISVKQFLFDPKSK 502 >ref|XP_004306131.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15300-like [Fragaria vesca subsp. vesca] Length = 540 Score = 151 bits (381), Expect = 1e-34 Identities = 70/111 (63%), Positives = 91/111 (81%) Frame = +2 Query: 2 AGLLNEAFEFVETMEIEPNSIIWRTLLGACRIQGNVELGKHTNERLLSMRWDHSGDYVLL 181 AGLL+EAF+ +E ME++PN+I+WRTLLGAC++ GNVELG+ NERLL +R D SGD+VLL Sbjct: 427 AGLLDEAFDCIENMEMQPNAIVWRTLLGACKVHGNVELGRRANERLLEIRGDESGDFVLL 486 Query: 182 ANIHASKGEWDGAERVRRLMDDRGVWKKPGCSLIDSAR*ELMHFLFDSKSK 334 +NI+AS+GEW GAE VR+LMDD GV K+ G S++++ L HFL DSKSK Sbjct: 487 SNIYASRGEWHGAEEVRKLMDDSGVKKEAGFSMVEADGHALKHFLLDSKSK 537 >ref|XP_006431200.1| hypothetical protein CICLE_v10011436mg [Citrus clementina] gi|557533257|gb|ESR44440.1| hypothetical protein CICLE_v10011436mg [Citrus clementina] Length = 540 Score = 149 bits (375), Expect = 5e-34 Identities = 69/111 (62%), Positives = 92/111 (82%) Frame = +2 Query: 2 AGLLNEAFEFVETMEIEPNSIIWRTLLGACRIQGNVELGKHTNERLLSMRWDHSGDYVLL 181 AGLL+EAFEF++ M+IEPN+IIWRTLLGACR+ G+VELG+ N+RLL+MR D SGDYVLL Sbjct: 422 AGLLDEAFEFIDNMDIEPNAIIWRTLLGACRVHGDVELGRLANKRLLNMRKDESGDYVLL 481 Query: 182 ANIHASKGEWDGAERVRRLMDDRGVWKKPGCSLIDSAR*ELMHFLFDSKSK 334 +NI+AS+GEW+ E+VR+LMDD + K+PGCSLI++ + +LF+ K K Sbjct: 482 SNIYASQGEWNRVEKVRKLMDDSDIKKQPGCSLIEADDKAFLQYLFNLKPK 532 >gb|EYU34053.1| hypothetical protein MIMGU_mgv1a004068mg [Mimulus guttatus] Length = 545 Score = 144 bits (364), Expect = 1e-32 Identities = 71/117 (60%), Positives = 88/117 (75%) Frame = +2 Query: 2 AGLLNEAFEFVETMEIEPNSIIWRTLLGACRIQGNVELGKHTNERLLSMRWDHSGDYVLL 181 AGLLNEAFEF++ ME EPN+IIWRTLLGACRI NVELG+ NE+LL +R D SGDYVLL Sbjct: 427 AGLLNEAFEFIDMMEFEPNAIIWRTLLGACRIHCNVELGRLANEKLLKLRRDESGDYVLL 486 Query: 182 ANIHASKGEWDGAERVRRLMDDRGVWKKPGCSLIDSAR*ELMHFLFDSKSKF*VQKT 352 +NI+AS GEW G E VR+LMD+ GV K+ G SL+D + E + FL S + +K+ Sbjct: 487 SNIYASNGEWSGVENVRKLMDETGVKKERGFSLVDEEKNEFLGFLLGSDHRANARKS 543 >ref|XP_006482626.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15300-like [Citrus sinensis] Length = 540 Score = 142 bits (358), Expect = 5e-32 Identities = 66/109 (60%), Positives = 90/109 (82%) Frame = +2 Query: 2 AGLLNEAFEFVETMEIEPNSIIWRTLLGACRIQGNVELGKHTNERLLSMRWDHSGDYVLL 181 AGLL+EAF+F++ M+IE N+IIWRTLLGACR+ G+VELG+ N+RLL+MR D SGDYVLL Sbjct: 422 AGLLDEAFKFIDNMDIEANAIIWRTLLGACRVHGDVELGRLANKRLLNMRKDESGDYVLL 481 Query: 182 ANIHASKGEWDGAERVRRLMDDRGVWKKPGCSLIDSAR*ELMHFLFDSK 328 +NI+AS+GEW+ E+VR+LMDD + K+PGCSLI++ + +LF+ K Sbjct: 482 SNIYASQGEWNRVEKVRKLMDDSEIKKQPGCSLIEADDKAFLQYLFNLK 530 >ref|XP_006400050.1| hypothetical protein EUTSA_v10015396mg [Eutrema salsugineum] gi|557101140|gb|ESQ41503.1| hypothetical protein EUTSA_v10015396mg [Eutrema salsugineum] Length = 547 Score = 142 bits (357), Expect = 6e-32 Identities = 71/118 (60%), Positives = 93/118 (78%), Gaps = 1/118 (0%) Frame = +2 Query: 2 AGLLNEAFEFVETMEIEPNSIIWRTLLGACRIQGNVELGKHTNERLLSMRWDHSGDYVLL 181 AGLL+EAF FVE+MEIEPN+I+WRTLLGACRI GNVELGK+ NE+LLS+R D SGDYVLL Sbjct: 429 AGLLDEAFMFVESMEIEPNAIVWRTLLGACRIYGNVELGKYANEKLLSLRKDESGDYVLL 488 Query: 182 ANIHASKGEWDGAERVRRLMDDRGVWKKPGCSLIDSAR*EL-MHFLFDSKSKF*VQKT 352 +NI+AS GEWD ++VR++ DD GV K G SLI+ +L M +L S+ + ++++ Sbjct: 489 SNIYASTGEWDRVQKVRKMFDDTGVKKPTGYSLIEEDDDKLMMRYLLSSEPESNIKRS 546 >ref|XP_002873718.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297319555|gb|EFH49977.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 548 Score = 139 bits (351), Expect = 3e-31 Identities = 69/112 (61%), Positives = 89/112 (79%), Gaps = 1/112 (0%) Frame = +2 Query: 2 AGLLNEAFEFVETMEIEPNSIIWRTLLGACRIQGNVELGKHTNERLLSMRWDHSGDYVLL 181 AGLL EAF FVE+M+IEPN+I+WRTLLGAC+I GNVELGK+ NE+LLSMR D SGDYVLL Sbjct: 429 AGLLEEAFMFVESMKIEPNAIVWRTLLGACKIYGNVELGKYANEKLLSMRKDESGDYVLL 488 Query: 182 ANIHASKGEWDGAERVRRLMDDRGVWKKPGCSLIDSAR*EL-MHFLFDSKSK 334 +NI+AS G+WDG ++VR++ DD V K G SLI+ +L M +L S+++ Sbjct: 489 SNIYASTGQWDGVQKVRKMFDDTRVKKPTGISLIEEDDDKLMMRYLLSSEAE 540 >ref|XP_006287429.1| hypothetical protein CARUB_v10000633mg [Capsella rubella] gi|482556135|gb|EOA20327.1| hypothetical protein CARUB_v10000633mg [Capsella rubella] Length = 548 Score = 137 bits (346), Expect = 1e-30 Identities = 69/112 (61%), Positives = 89/112 (79%), Gaps = 1/112 (0%) Frame = +2 Query: 2 AGLLNEAFEFVETMEIEPNSIIWRTLLGACRIQGNVELGKHTNERLLSMRWDHSGDYVLL 181 AGLL+EAF FVE+M+IEPN+I+WRTLLGAC+I GNVELGK+ NERLLSMR D SGDYVLL Sbjct: 429 AGLLDEAFMFVESMKIEPNAIVWRTLLGACKIYGNVELGKYANERLLSMRKDESGDYVLL 488 Query: 182 ANIHASKGEWDGAERVRRLMDDRGVWKKPGCSLIDSAR*EL-MHFLFDSKSK 334 +NI+AS GEW+ ++VR++ DD V K G S+I+ +L M +L S+S+ Sbjct: 489 SNIYASTGEWEAVQKVRKMFDDTRVKKPTGISVIEEDDDKLMMRYLLASESE 540 >ref|NP_197034.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|223635759|sp|Q9LXF2.2|PP385_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g15300 gi|332004762|gb|AED92145.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 548 Score = 136 bits (343), Expect = 3e-30 Identities = 66/102 (64%), Positives = 82/102 (80%) Frame = +2 Query: 2 AGLLNEAFEFVETMEIEPNSIIWRTLLGACRIQGNVELGKHTNERLLSMRWDHSGDYVLL 181 AG L EAF FVE+M+IEPN+I+WRTLLGAC+I GNVELGK+ NE+LLSMR D SGDYVLL Sbjct: 429 AGQLEEAFMFVESMKIEPNAIVWRTLLGACKIYGNVELGKYANEKLLSMRKDESGDYVLL 488 Query: 182 ANIHASKGEWDGAERVRRLMDDRGVWKKPGCSLIDSAR*ELM 307 +NI+AS G+WDG ++VR++ DD V K G SLI+ +LM Sbjct: 489 SNIYASTGQWDGVQKVRKMFDDTRVKKPTGVSLIEEDDDKLM 530 >emb|CAB89340.1| putative protein [Arabidopsis thaliana] Length = 514 Score = 136 bits (343), Expect = 3e-30 Identities = 66/102 (64%), Positives = 82/102 (80%) Frame = +2 Query: 2 AGLLNEAFEFVETMEIEPNSIIWRTLLGACRIQGNVELGKHTNERLLSMRWDHSGDYVLL 181 AG L EAF FVE+M+IEPN+I+WRTLLGAC+I GNVELGK+ NE+LLSMR D SGDYVLL Sbjct: 395 AGQLEEAFMFVESMKIEPNAIVWRTLLGACKIYGNVELGKYANEKLLSMRKDESGDYVLL 454 Query: 182 ANIHASKGEWDGAERVRRLMDDRGVWKKPGCSLIDSAR*ELM 307 +NI+AS G+WDG ++VR++ DD V K G SLI+ +LM Sbjct: 455 SNIYASTGQWDGVQKVRKMFDDTRVKKPTGVSLIEEDDDKLM 496 >ref|XP_003551738.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15300-like [Glycine max] Length = 518 Score = 136 bits (342), Expect = 3e-30 Identities = 61/96 (63%), Positives = 79/96 (82%) Frame = +2 Query: 2 AGLLNEAFEFVETMEIEPNSIIWRTLLGACRIQGNVELGKHTNERLLSMRWDHSGDYVLL 181 AGLL EAF F+ +M+IEPN+I+WR+LLGAC++ G+VEL K NE+LL MR D SGDYVLL Sbjct: 421 AGLLKEAFNFIASMKIEPNAIVWRSLLGACKVHGDVELAKRANEQLLRMRGDQSGDYVLL 480 Query: 182 ANIHASKGEWDGAERVRRLMDDRGVWKKPGCSLIDS 289 +N++AS+GEWDGAE VR+LMDD GV K G S +++ Sbjct: 481 SNVYASQGEWDGAENVRKLMDDNGVTKNRGSSFVEA 516