BLASTX nr result
ID: Akebia24_contig00010084
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00010084 (243 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515214.1| conserved hypothetical protein [Ricinus comm... 65 1e-08 ref|XP_007051233.1| Uncharacterized protein isoform 1 [Theobroma... 61 1e-07 ref|XP_004288355.1| PREDICTED: uncharacterized protein LOC101294... 59 9e-07 ref|XP_007221489.1| hypothetical protein PRUPE_ppa008208mg [Prun... 57 3e-06 >ref|XP_002515214.1| conserved hypothetical protein [Ricinus communis] gi|223545694|gb|EEF47198.1| conserved hypothetical protein [Ricinus communis] Length = 338 Score = 65.1 bits (157), Expect = 1e-08 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -3 Query: 241 IHIPCYGFYALIVKAKNSFFPRWFPHAYVRPY 146 +HIPCYG Y+LIVKAKNS FP+WFPHA+VR Y Sbjct: 307 VHIPCYGIYSLIVKAKNSIFPKWFPHAFVRSY 338 >ref|XP_007051233.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|508703494|gb|EOX95390.1| Uncharacterized protein isoform 1 [Theobroma cacao] Length = 343 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = -3 Query: 241 IHIPCYGFYALIVKAKNSFFPRWFPHAYVRPY*Y 140 +HIPCYG YALIVKAKNS PR FPHA+VR Y Y Sbjct: 310 VHIPCYGIYALIVKAKNSILPRLFPHAFVRSYSY 343 >ref|XP_004288355.1| PREDICTED: uncharacterized protein LOC101294794 [Fragaria vesca subsp. vesca] Length = 330 Score = 58.5 bits (140), Expect = 9e-07 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = -3 Query: 241 IHIPCYGFYALIVKAKNSFFPRWFPHAYVRPY 146 IHIPCYG +ALI+KAK + FP+ FPHA+VRPY Sbjct: 299 IHIPCYGIFALIIKAKYTIFPKLFPHAFVRPY 330 >ref|XP_007221489.1| hypothetical protein PRUPE_ppa008208mg [Prunus persica] gi|462418239|gb|EMJ22688.1| hypothetical protein PRUPE_ppa008208mg [Prunus persica] Length = 341 Score = 56.6 bits (135), Expect = 3e-06 Identities = 21/31 (67%), Positives = 27/31 (87%) Frame = -3 Query: 241 IHIPCYGFYALIVKAKNSFFPRWFPHAYVRP 149 +HIPCYG +ALI+KAK S P+WFP+A+VRP Sbjct: 310 VHIPCYGIFALIIKAKYSLLPKWFPNAFVRP 340