BLASTX nr result
ID: Akebia24_contig00008534
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00008534 (237 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006477112.1| PREDICTED: plasminogen activator inhibitor 1... 72 8e-11 ref|XP_006440205.1| hypothetical protein CICLE_v10020747mg [Citr... 72 8e-11 ref|XP_002303373.2| nuclear RNA-binding family protein [Populus ... 70 3e-10 dbj|BAE71280.1| putative nuclear antigen homolog [Trifolium prat... 70 3e-10 dbj|BAE71204.1| putative nuclear antigen homolog [Trifolium prat... 70 3e-10 ref|XP_007139646.1| hypothetical protein PHAVU_008G047300g [Phas... 69 7e-10 ref|XP_002531778.1| Plasminogen activator inhibitor 1 RNA-bindin... 69 7e-10 emb|CAC85228.1| salt tolerance protein 2 [Beta vulgaris] 69 9e-10 ref|XP_006368965.1| nuclear RNA-binding family protein [Populus ... 69 9e-10 gb|ABK94426.1| unknown [Populus trichocarpa] 69 9e-10 ref|XP_003521066.1| PREDICTED: plasminogen activator inhibitor 1... 68 2e-09 ref|XP_002511578.1| RNA binding protein, putative [Ricinus commu... 68 2e-09 ref|XP_007052327.1| Hyaluronan / mRNA binding family isoform 1 [... 67 2e-09 ref|XP_003624316.1| Transcription factor [Medicago truncatula] g... 67 2e-09 ref|NP_001275394.1| nuclear RNA binding protein [Solanum tuberos... 67 3e-09 ref|XP_002266051.1| PREDICTED: uncharacterized protein LOC100265... 67 3e-09 emb|CAN75176.1| hypothetical protein VITISV_016687 [Vitis vinifera] 67 3e-09 gb|EYU19467.1| hypothetical protein MIMGU_mgv1a008831mg [Mimulus... 67 3e-09 ref|XP_006837401.1| hypothetical protein AMTR_s00111p00140620 [A... 67 3e-09 gb|EPS59059.1| hypothetical protein M569_15751 [Genlisea aurea] 67 3e-09 >ref|XP_006477112.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like isoform X1 [Citrus sinensis] Length = 364 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/42 (78%), Positives = 35/42 (83%) Frame = -2 Query: 143 PRRYFERRSGTGRGNVINREGAGRGNWGTTNDEIVQESEEIV 18 PRR FERRSGTGRGN I R+GAGRGNWGT DEI QE+EE V Sbjct: 154 PRRVFERRSGTGRGNEIKRDGAGRGNWGTPTDEIAQETEEPV 195 >ref|XP_006440205.1| hypothetical protein CICLE_v10020747mg [Citrus clementina] gi|557542467|gb|ESR53445.1| hypothetical protein CICLE_v10020747mg [Citrus clementina] Length = 364 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/42 (78%), Positives = 35/42 (83%) Frame = -2 Query: 143 PRRYFERRSGTGRGNVINREGAGRGNWGTTNDEIVQESEEIV 18 PRR FERRSGTGRGN I R+GAGRGNWGT DEI QE+EE V Sbjct: 154 PRRVFERRSGTGRGNEIKRDGAGRGNWGTPTDEIAQETEEPV 195 >ref|XP_002303373.2| nuclear RNA-binding family protein [Populus trichocarpa] gi|550342671|gb|EEE78352.2| nuclear RNA-binding family protein [Populus trichocarpa] Length = 361 Score = 70.1 bits (170), Expect = 3e-10 Identities = 30/47 (63%), Positives = 37/47 (78%) Frame = -2 Query: 143 PRRYFERRSGTGRGNVINREGAGRGNWGTTNDEIVQESEEIVITNDR 3 PRR +ER SGTGRGN I REG+GRGNWGT DEI E+E+ V+ N++ Sbjct: 148 PRRMYERHSGTGRGNEIKREGSGRGNWGTPTDEIAPETEDPVVDNEK 194 >dbj|BAE71280.1| putative nuclear antigen homolog [Trifolium pratense] Length = 371 Score = 70.1 bits (170), Expect = 3e-10 Identities = 32/47 (68%), Positives = 35/47 (74%) Frame = -2 Query: 143 PRRYFERRSGTGRGNVINREGAGRGNWGTTNDEIVQESEEIVITNDR 3 PRR FER SGTGRGN REGAGRGNWGT DEI Q +EE VI ++ Sbjct: 161 PRRTFERHSGTGRGNEFKREGAGRGNWGTETDEIAQVTEEAVIEGEK 207 >dbj|BAE71204.1| putative nuclear antigen homolog [Trifolium pratense] Length = 371 Score = 70.1 bits (170), Expect = 3e-10 Identities = 32/47 (68%), Positives = 35/47 (74%) Frame = -2 Query: 143 PRRYFERRSGTGRGNVINREGAGRGNWGTTNDEIVQESEEIVITNDR 3 PRR FER SGTGRGN REGAGRGNWGT DEI Q +EE VI ++ Sbjct: 161 PRRTFERHSGTGRGNEFKREGAGRGNWGTETDEIAQVTEEAVIEGEK 207 >ref|XP_007139646.1| hypothetical protein PHAVU_008G047300g [Phaseolus vulgaris] gi|561012779|gb|ESW11640.1| hypothetical protein PHAVU_008G047300g [Phaseolus vulgaris] Length = 365 Score = 68.9 bits (167), Expect = 7e-10 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = -2 Query: 143 PRRYFERRSGTGRGNVINREGAGRGNWGTTNDEIVQESEEIV 18 PRR ++RRSGTGRGN REGAGRGNWGT ND+I + +EE+V Sbjct: 156 PRRAYDRRSGTGRGNEFKREGAGRGNWGTQNDDITETTEEVV 197 >ref|XP_002531778.1| Plasminogen activator inhibitor 1 RNA-binding protein, putative [Ricinus communis] gi|223528571|gb|EEF30592.1| Plasminogen activator inhibitor 1 RNA-binding protein, putative [Ricinus communis] Length = 364 Score = 68.9 bits (167), Expect = 7e-10 Identities = 31/47 (65%), Positives = 36/47 (76%) Frame = -2 Query: 143 PRRYFERRSGTGRGNVINREGAGRGNWGTTNDEIVQESEEIVITNDR 3 PRR ++RRSGTGRGN REGAGRGNWGT DEI E EE +I N++ Sbjct: 156 PRRLYDRRSGTGRGNEFKREGAGRGNWGTPADEIAPEIEEPLIENEK 202 >emb|CAC85228.1| salt tolerance protein 2 [Beta vulgaris] Length = 356 Score = 68.6 bits (166), Expect = 9e-10 Identities = 30/46 (65%), Positives = 36/46 (78%) Frame = -2 Query: 143 PRRYFERRSGTGRGNVINREGAGRGNWGTTNDEIVQESEEIVITND 6 PRR +ERRSGTGRG I REG+GRGNWG+ DEI E+EE V+ N+ Sbjct: 148 PRRMYERRSGTGRGGEIKREGSGRGNWGSPTDEIAPETEEPVVENE 193 >ref|XP_006368965.1| nuclear RNA-binding family protein [Populus trichocarpa] gi|550347324|gb|ERP65534.1| nuclear RNA-binding family protein [Populus trichocarpa] Length = 374 Score = 68.6 bits (166), Expect = 9e-10 Identities = 29/47 (61%), Positives = 37/47 (78%) Frame = -2 Query: 143 PRRYFERRSGTGRGNVINREGAGRGNWGTTNDEIVQESEEIVITNDR 3 PRR ++R SGTGRGN + REG+GRGNWGT DEI E+EE V+ N++ Sbjct: 160 PRRQYDRHSGTGRGNELKREGSGRGNWGTPADEIAPETEEPVVDNEK 206 >gb|ABK94426.1| unknown [Populus trichocarpa] Length = 370 Score = 68.6 bits (166), Expect = 9e-10 Identities = 29/47 (61%), Positives = 37/47 (78%) Frame = -2 Query: 143 PRRYFERRSGTGRGNVINREGAGRGNWGTTNDEIVQESEEIVITNDR 3 PRR ++R SGTGRGN + REG+GRGNWGT DEI E+EE V+ N++ Sbjct: 156 PRRQYDRHSGTGRGNELKREGSGRGNWGTPADEIAPETEEPVVDNEK 202 >ref|XP_003521066.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like [Glycine max] Length = 368 Score = 67.8 bits (164), Expect = 2e-09 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = -2 Query: 143 PRRYFERRSGTGRGNVINREGAGRGNWGTTNDEIVQESEEIV 18 PRR FER SGTGRGN REG+GRGNWGT ND+I + +EE+V Sbjct: 160 PRRAFERHSGTGRGNEFKREGSGRGNWGTQNDDIAEVTEEVV 201 >ref|XP_002511578.1| RNA binding protein, putative [Ricinus communis] gi|223548758|gb|EEF50247.1| RNA binding protein, putative [Ricinus communis] Length = 295 Score = 67.8 bits (164), Expect = 2e-09 Identities = 31/42 (73%), Positives = 32/42 (76%) Frame = -2 Query: 143 PRRYFERRSGTGRGNVINREGAGRGNWGTTNDEIVQESEEIV 18 PRR FERRSGTG GN REGAGRGNWGT DEI Q +EE V Sbjct: 157 PRRAFERRSGTGHGNEFKREGAGRGNWGTNTDEIAQVTEEAV 198 >ref|XP_007052327.1| Hyaluronan / mRNA binding family isoform 1 [Theobroma cacao] gi|590723951|ref|XP_007052328.1| Hyaluronan / mRNA binding family isoform 1 [Theobroma cacao] gi|590723955|ref|XP_007052329.1| Hyaluronan / mRNA binding family isoform 1 [Theobroma cacao] gi|508704588|gb|EOX96484.1| Hyaluronan / mRNA binding family isoform 1 [Theobroma cacao] gi|508704589|gb|EOX96485.1| Hyaluronan / mRNA binding family isoform 1 [Theobroma cacao] gi|508704590|gb|EOX96486.1| Hyaluronan / mRNA binding family isoform 1 [Theobroma cacao] Length = 375 Score = 67.4 bits (163), Expect = 2e-09 Identities = 28/47 (59%), Positives = 37/47 (78%) Frame = -2 Query: 143 PRRYFERRSGTGRGNVINREGAGRGNWGTTNDEIVQESEEIVITNDR 3 PRR +ER SGTGRGN + REG+GRGNWGT DE+ Q +EE+V +++ Sbjct: 166 PRRMYERHSGTGRGNELKREGSGRGNWGTQTDELAQVTEEVVNESEK 212 >ref|XP_003624316.1| Transcription factor [Medicago truncatula] gi|355499331|gb|AES80534.1| Transcription factor [Medicago truncatula] Length = 625 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/42 (71%), Positives = 33/42 (78%) Frame = -2 Query: 143 PRRYFERRSGTGRGNVINREGAGRGNWGTTNDEIVQESEEIV 18 PRR FER SGTGRGN REGAGRGNWGT DEI Q +EE++ Sbjct: 167 PRRTFERHSGTGRGNDFKREGAGRGNWGTETDEIAQVTEEVM 208 >ref|NP_001275394.1| nuclear RNA binding protein [Solanum tuberosum] gi|257215078|emb|CAR64523.1| nuclear RNA binding protein [Solanum tuberosum] Length = 360 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/41 (73%), Positives = 33/41 (80%) Frame = -2 Query: 143 PRRYFERRSGTGRGNVINREGAGRGNWGTTNDEIVQESEEI 21 PRR FERRSGTGRGN I REGAGRGNWGT DE+ Q + E+ Sbjct: 152 PRRTFERRSGTGRGNEIKREGAGRGNWGTEADEVTQMTGEV 192 >ref|XP_002266051.1| PREDICTED: uncharacterized protein LOC100265608 [Vitis vinifera] gi|296085734|emb|CBI29539.3| unnamed protein product [Vitis vinifera] Length = 363 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = -2 Query: 143 PRRYFERRSGTGRGNVINREGAGRGNWGTTNDEIVQESEE 24 PRR +ERRSGTGRGN I R+GAGRGNWGT DEI E+EE Sbjct: 156 PRRAYERRSGTGRGNEIKRDGAGRGNWGTPADEIAPENEE 195 >emb|CAN75176.1| hypothetical protein VITISV_016687 [Vitis vinifera] Length = 363 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = -2 Query: 143 PRRYFERRSGTGRGNVINREGAGRGNWGTTNDEIVQESEE 24 PRR +ERRSGTGRGN I R+GAGRGNWGT DEI E+EE Sbjct: 156 PRRAYERRSGTGRGNEIKRDGAGRGNWGTPADEIAPENEE 195 >gb|EYU19467.1| hypothetical protein MIMGU_mgv1a008831mg [Mimulus guttatus] gi|604299594|gb|EYU19468.1| hypothetical protein MIMGU_mgv1a008831mg [Mimulus guttatus] Length = 361 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/40 (77%), Positives = 32/40 (80%) Frame = -2 Query: 143 PRRYFERRSGTGRGNVINREGAGRGNWGTTNDEIVQESEE 24 PRR FERRSGTG GN I REG GRGNWGT N+EIV E EE Sbjct: 147 PRRPFERRSGTGHGNEIKREGFGRGNWGTPNEEIVPEIEE 186 >ref|XP_006837401.1| hypothetical protein AMTR_s00111p00140620 [Amborella trichopoda] gi|548840019|gb|ERN00255.1| hypothetical protein AMTR_s00111p00140620 [Amborella trichopoda] Length = 362 Score = 66.6 bits (161), Expect = 3e-09 Identities = 33/48 (68%), Positives = 36/48 (75%), Gaps = 1/48 (2%) Frame = -2 Query: 143 PRRYFERRSGTGRGNVINREGAGRGNWGTTNDE-IVQESEEIVITNDR 3 PRR FERRSGTGRGN R+GAGRGNWG DE VQESEE+V N + Sbjct: 148 PRRQFERRSGTGRGNEFKRDGAGRGNWGAPIDEGAVQESEEVVGENGK 195 >gb|EPS59059.1| hypothetical protein M569_15751 [Genlisea aurea] Length = 391 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/47 (63%), Positives = 35/47 (74%) Frame = -2 Query: 143 PRRYFERRSGTGRGNVINREGAGRGNWGTTNDEIVQESEEIVITNDR 3 PRR F+RRSGTGRGN REGAGRGNWGT DE+ EEIV +++ Sbjct: 169 PRRPFDRRSGTGRGNEFKREGAGRGNWGTKTDELAHVPEEIVNEDEK 215