BLASTX nr result
ID: Akebia24_contig00007797
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00007797 (344 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_002475383.1| hydrolase [Staphylococcus epidermidis] gi|36... 72 6e-19 ref|WP_010686434.1| Hypothetical protein [Methylobacterium mesop... 68 9e-19 ref|WP_007811012.1| hydrolase [Roseobacter sp. AzwK-3b] gi|14981... 64 9e-19 ref|WP_001654640.1| hypothetical protein [Staphylococcus aureus]... 70 1e-18 dbj|BAH73833.1| hypothetical protein [Desulfovibrio magneticus R... 69 1e-18 ref|WP_001794454.1| hydrolase [Staphylococcus aureus] gi|2572759... 70 1e-18 ref|WP_001819373.1| cell wall-associated hydrolase family protei... 70 1e-18 ref|WP_006009510.1| hydrolase [Desulfovibrio piger] gi|212671492... 64 2e-18 ref|WP_001827368.1| hydrolase [Staphylococcus aureus] gi|3777471... 69 3e-18 ref|WP_021777892.1| hypothetical protein [alpha proteobacterium ... 64 5e-18 ref|XP_003088200.1| hypothetical protein CRE_03576 [Caenorhabdit... 64 5e-18 ref|WP_002969628.1| hydrolase [Brucella] gi|260095405|gb|EEW7928... 62 2e-17 gb|EXX41465.1| putative cell wall-associated hydrolase [Acinetob... 64 2e-17 gb|EXT02985.1| putative cell wall-associated hydrolase [Acinetob... 64 2e-17 gb|EXH74083.1| putative cell wall-associated hydrolase [Acinetob... 64 2e-17 ref|YP_008210737.1| hypothetical protein BJAB07104_03274 [Acinet... 64 2e-17 gb|EXC83814.1| putative cell wall-associated hydrolase, partial ... 64 2e-17 gb|EXC73208.1| putative cell wall-associated hydrolase, partial ... 64 2e-17 gb|EXC78953.1| putative cell wall-associated hydrolase, partial ... 64 2e-17 gb|EXC76937.1| putative cell wall-associated hydrolase, partial ... 64 2e-17 >ref|WP_002475383.1| hydrolase [Staphylococcus epidermidis] gi|365232177|gb|EHM73188.1| hypothetical protein HMPREF9956_2590 [Staphylococcus epidermidis 14.1.R1.SE] Length = 105 Score = 71.6 bits (174), Expect(2) = 6e-19 Identities = 33/44 (75%), Positives = 37/44 (84%) Frame = +2 Query: 137 MLSAVIPSVHSYPAAPLARRQVHQRYVQPGPLVLGSTPLKFRRP 268 MLSA+IPS+HSYPA PLAR+ VHQRYV PGPLVL + PLKF P Sbjct: 1 MLSALIPSIHSYPAMPLARQLVHQRYVHPGPLVLRTAPLKFPTP 44 Score = 48.1 bits (113), Expect(2) = 6e-19 Identities = 22/27 (81%), Positives = 24/27 (88%) Frame = +1 Query: 262 TPTADRDQTVSRRSKPSSRTTLNGEQP 342 TPT DRD+TVSRRS+PSSRT L GEQP Sbjct: 43 TPTTDRDRTVSRRSEPSSRTALMGEQP 69 >ref|WP_010686434.1| Hypothetical protein [Methylobacterium mesophilicum] gi|473433374|gb|EMS40254.1| Hypothetical protein MmSR116_4659 [Methylobacterium mesophilicum SR1.6/6] Length = 152 Score = 67.8 bits (164), Expect(2) = 9e-19 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = +2 Query: 137 MLSAVIPSVHSYPAAPLARRQVHQRYVQPGPLVLGSTPLK 256 M SAVIPSVHSY A PLAR+Q+HQRYV PGPLVLG+ PLK Sbjct: 1 MPSAVIPSVHSYAALPLARQQLHQRYVHPGPLVLGTKPLK 40 Score = 51.2 bits (121), Expect(2) = 9e-19 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = +1 Query: 262 TPTADRDQTVSRRSKPSSRTTLNGEQP 342 TPTADRD+TVSRRS+PSSRTTL GEQP Sbjct: 43 TPTADRDRTVSRRSEPSSRTTLIGEQP 69 >ref|WP_007811012.1| hydrolase [Roseobacter sp. AzwK-3b] gi|149810350|gb|EDM70195.1| Cell wall-associated hydrolase [Roseobacter sp. AzwK-3b] gi|149812844|gb|EDM72670.1| Cell wall-associated hydrolase [Roseobacter sp. AzwK-3b] Length = 152 Score = 64.3 bits (155), Expect(2) = 9e-19 Identities = 32/44 (72%), Positives = 35/44 (79%) Frame = +2 Query: 137 MLSAVIPSVHSYPAAPLARRQVHQRYVQPGPLVLGSTPLKFRRP 268 M SAVI S HSYPA PLAR+QVHQ V PGPLVLG+TPLK+ P Sbjct: 1 MPSAVILSDHSYPALPLARQQVHQWIVHPGPLVLGATPLKYPTP 44 Score = 54.7 bits (130), Expect(2) = 9e-19 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = +1 Query: 262 TPTADRDQTVSRRSKPSSRTTLNGEQP 342 TPTADRD+TVSRRSKPSSRT+LNGEQP Sbjct: 43 TPTADRDRTVSRRSKPSSRTSLNGEQP 69 >ref|WP_001654640.1| hypothetical protein [Staphylococcus aureus] gi|477890270|gb|ENL04231.1| hypothetical protein B460_00403 [Staphylococcus aureus M0673] Length = 122 Score = 70.5 bits (171), Expect(2) = 1e-18 Identities = 33/44 (75%), Positives = 36/44 (81%) Frame = +2 Query: 137 MLSAVIPSVHSYPAAPLARRQVHQRYVQPGPLVLGSTPLKFRRP 268 MLSA+IPS HSYPA PLAR+ VHQRYV PGPLVL + PLKF P Sbjct: 1 MLSALIPSTHSYPAMPLARQLVHQRYVHPGPLVLRTAPLKFPTP 44 Score = 48.1 bits (113), Expect(2) = 1e-18 Identities = 22/27 (81%), Positives = 24/27 (88%) Frame = +1 Query: 262 TPTADRDQTVSRRSKPSSRTTLNGEQP 342 TPT DRD+TVSRRS+PSSRT L GEQP Sbjct: 43 TPTTDRDRTVSRRSEPSSRTALMGEQP 69 >dbj|BAH73833.1| hypothetical protein [Desulfovibrio magneticus RS-1] gi|239798250|dbj|BAH77239.1| hypothetical protein [Desulfovibrio magneticus RS-1] Length = 122 Score = 68.6 bits (166), Expect(2) = 1e-18 Identities = 33/46 (71%), Positives = 37/46 (80%) Frame = +2 Query: 137 MLSAVIPSVHSYPAAPLARRQVHQRYVQPGPLVLGSTPLKFRRPRQ 274 MLSAVI S HSYPA PLAR+QVHQR+V PGPLVLG+TPL P + Sbjct: 1 MLSAVILSEHSYPAMPLARQQVHQRFVHPGPLVLGTTPLNSPTPTE 46 Score = 50.1 bits (118), Expect(2) = 1e-18 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = +1 Query: 262 TPTADRDQTVSRRSKPSSRTTLNGEQP 342 TPT DRDQTVSRR KPSSRTTL GEQP Sbjct: 43 TPTEDRDQTVSRRFKPSSRTTLIGEQP 69 >ref|WP_001794454.1| hydrolase [Staphylococcus aureus] gi|257275964|gb|EEV07415.1| cell wall-associated hydrolase [Staphylococcus aureus subsp. aureus 65-1322] gi|257855941|gb|EEV78863.1| cell wall-associated hydrolase [Staphylococcus aureus A6300] gi|290921289|gb|EFD98348.1| cell wall-associated hydrolase [Staphylococcus aureus subsp. aureus M1015] gi|320141322|gb|EFW33166.1| hypothetical protein HMPREF9528_00397 [Staphylococcus aureus subsp. aureus MRSA131] gi|323438382|gb|EGA96145.1| hypothetical protein SAO11_2757 [Staphylococcus aureus O11] gi|323441224|gb|EGA98901.1| hypothetical protein SAO46_2803 [Staphylococcus aureus O46] gi|377716412|gb|EHT40594.1| cell wall-associated hydrolase family protein [Staphylococcus aureus subsp. aureus CIG1750] gi|377716842|gb|EHT41021.1| cell wall-associated hydrolase family protein [Staphylococcus aureus subsp. aureus CIG1750] gi|377743374|gb|EHT67357.1| cell wall-associated hydrolase family protein [Staphylococcus aureus subsp. aureus CIG290] gi|377747250|gb|EHT71215.1| cell wall-associated hydrolase family protein [Staphylococcus aureus subsp. aureus CIG290] gi|394328922|gb|EJE55072.1| hypothetical protein Newbould305_2751 [Staphylococcus aureus subsp. aureus str. Newbould 305] gi|507193514|gb|EOR35168.1| hypothetical protein S091751_1002 [Staphylococcus aureus subsp. aureus 091751] gi|507198425|gb|EOR39444.1| hypothetical protein MRGR3_1872 [Staphylococcus aureus subsp. aureus MRGR3] gi|507237654|gb|EOR47684.1| hypothetical protein M140OLGA_2051 [Staphylococcus aureus subsp. aureus 112808A] Length = 105 Score = 70.5 bits (171), Expect(2) = 1e-18 Identities = 33/44 (75%), Positives = 36/44 (81%) Frame = +2 Query: 137 MLSAVIPSVHSYPAAPLARRQVHQRYVQPGPLVLGSTPLKFRRP 268 MLSA+IPS HSYPA PLAR+ VHQRYV PGPLVL + PLKF P Sbjct: 1 MLSALIPSTHSYPAMPLARQLVHQRYVHPGPLVLRTAPLKFPTP 44 Score = 48.1 bits (113), Expect(2) = 1e-18 Identities = 22/27 (81%), Positives = 24/27 (88%) Frame = +1 Query: 262 TPTADRDQTVSRRSKPSSRTTLNGEQP 342 TPT DRD+TVSRRS+PSSRT L GEQP Sbjct: 43 TPTTDRDRTVSRRSEPSSRTALMGEQP 69 >ref|WP_001819373.1| cell wall-associated hydrolase family protein, partial [Staphylococcus aureus] gi|377698324|gb|EHT22672.1| cell wall-associated hydrolase family protein, partial [Staphylococcus aureus subsp. aureus CIG1057] Length = 76 Score = 70.5 bits (171), Expect(2) = 1e-18 Identities = 33/44 (75%), Positives = 36/44 (81%) Frame = +2 Query: 137 MLSAVIPSVHSYPAAPLARRQVHQRYVQPGPLVLGSTPLKFRRP 268 MLSA+IPS HSYPA PLAR+ VHQRYV PGPLVL + PLKF P Sbjct: 1 MLSALIPSTHSYPAMPLARQLVHQRYVHPGPLVLRTAPLKFPTP 44 Score = 48.1 bits (113), Expect(2) = 1e-18 Identities = 22/27 (81%), Positives = 24/27 (88%) Frame = +1 Query: 262 TPTADRDQTVSRRSKPSSRTTLNGEQP 342 TPT DRD+TVSRRS+PSSRT L GEQP Sbjct: 43 TPTTDRDRTVSRRSEPSSRTALMGEQP 69 >ref|WP_006009510.1| hydrolase [Desulfovibrio piger] gi|212671492|gb|EEB31975.1| hypothetical protein DESPIG_03156 [Desulfovibrio piger ATCC 29098] Length = 112 Score = 64.3 bits (155), Expect(2) = 2e-18 Identities = 31/46 (67%), Positives = 34/46 (73%) Frame = +2 Query: 137 MLSAVIPSVHSYPAAPLARRQVHQRYVQPGPLVLGSTPLKFRRPRQ 274 MLSAVIPS HSYPA PLAR+QVHQ V PGPLVLG+ P P + Sbjct: 1 MLSAVIPSTHSYPAVPLARQQVHQWCVHPGPLVLGTGPFNSPTPTE 46 Score = 53.5 bits (127), Expect(2) = 2e-18 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = +1 Query: 262 TPTADRDQTVSRRSKPSSRTTLNGEQP 342 TPT DRDQTVSRR KPSSRTTLNGEQP Sbjct: 43 TPTEDRDQTVSRRFKPSSRTTLNGEQP 69 >ref|WP_001827368.1| hydrolase [Staphylococcus aureus] gi|377747194|gb|EHT71160.1| cell wall-associated hydrolase family protein [Staphylococcus aureus subsp. aureus CIG290] Length = 105 Score = 69.3 bits (168), Expect(2) = 3e-18 Identities = 33/44 (75%), Positives = 35/44 (79%) Frame = +2 Query: 137 MLSAVIPSVHSYPAAPLARRQVHQRYVQPGPLVLGSTPLKFRRP 268 MLSA+IPS HSYPA PLAR+ VHQRYV PGPLVL PLKF P Sbjct: 1 MLSALIPSTHSYPAMPLARQLVHQRYVHPGPLVLRIAPLKFPTP 44 Score = 48.1 bits (113), Expect(2) = 3e-18 Identities = 22/27 (81%), Positives = 24/27 (88%) Frame = +1 Query: 262 TPTADRDQTVSRRSKPSSRTTLNGEQP 342 TPT DRD+TVSRRS+PSSRT L GEQP Sbjct: 43 TPTTDRDRTVSRRSEPSSRTALMGEQP 69 >ref|WP_021777892.1| hypothetical protein [alpha proteobacterium RS24] gi|544591571|gb|ERL45919.1| hypothetical protein RS24_01960 [alpha proteobacterium RS24] Length = 152 Score = 64.3 bits (155), Expect(2) = 5e-18 Identities = 31/44 (70%), Positives = 35/44 (79%) Frame = +2 Query: 137 MLSAVIPSVHSYPAAPLARRQVHQRYVQPGPLVLGSTPLKFRRP 268 MLSAVIPS+ SY A P AR+Q+ QRYV PGPLVLG+ PLKF P Sbjct: 1 MLSAVIPSILSYAAMPQARQQLDQRYVHPGPLVLGTAPLKFPTP 44 Score = 52.4 bits (124), Expect(2) = 5e-18 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = +1 Query: 262 TPTADRDQTVSRRSKPSSRTTLNGEQP 342 TPTADRDQTVSRRSKPSSRT L GEQP Sbjct: 43 TPTADRDQTVSRRSKPSSRTALIGEQP 69 >ref|XP_003088200.1| hypothetical protein CRE_03576 [Caenorhabditis remanei] gi|308248801|gb|EFO92753.1| hypothetical protein CRE_03576 [Caenorhabditis remanei] Length = 122 Score = 63.5 bits (153), Expect(2) = 5e-18 Identities = 31/44 (70%), Positives = 34/44 (77%) Frame = +2 Query: 137 MLSAVIPSVHSYPAAPLARRQVHQRYVQPGPLVLGSTPLKFRRP 268 MLSAVIPS HSYPA LA + VHQR+V GPLVLG+ PLKF P Sbjct: 1 MLSAVIPSEHSYPAMRLASQPVHQRFVHSGPLVLGADPLKFPTP 44 Score = 53.1 bits (126), Expect(2) = 5e-18 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = +1 Query: 262 TPTADRDQTVSRRSKPSSRTTLNGEQP 342 TPT DRD+TVSRRSKPSSRT+LNGEQP Sbjct: 43 TPTVDRDRTVSRRSKPSSRTSLNGEQP 69 >ref|WP_002969628.1| hydrolase [Brucella] gi|260095405|gb|EEW79284.1| cell wall-associated hydrolase [Brucella abortus NCTC 8038] gi|260151029|gb|EEW86125.1| cell wall-associated hydrolase [Brucella melitensis bv. 1 str. 16M] gi|260924847|gb|EEX91415.1| cell wall-associated hydrolase [Brucella ceti M13/05/1] gi|261295337|gb|EEX98833.1| cell wall-associated hydrolase [Brucella ceti M644/93/1] gi|261295369|gb|EEX98865.1| cell wall-associated hydrolase [Brucella pinnipedialis B2/94] gi|261303002|gb|EEY06499.1| cell wall-associated hydrolase [Brucella pinnipedialis M163/99/10] gi|262551237|gb|EEZ07328.1| cell wall-associated hydrolase [Brucella ceti M490/95/1] gi|264663252|gb|EEZ33513.1| cell wall-associated hydrolase [Brucella sp. 83/13] Length = 152 Score = 62.0 bits (149), Expect(2) = 2e-17 Identities = 30/44 (68%), Positives = 34/44 (77%) Frame = +2 Query: 137 MLSAVIPSVHSYPAAPLARRQVHQRYVQPGPLVLGSTPLKFRRP 268 M SAVIPSV+SYPA LA +QVHQRYV PGPLVLG+ P+ P Sbjct: 1 MPSAVIPSVYSYPAMRLAPQQVHQRYVHPGPLVLGTDPVNIPTP 44 Score = 52.8 bits (125), Expect(2) = 2e-17 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = +1 Query: 256 ISTPTADRDQTVSRRSKPSSRTTLNGEQP 342 I TPTADRD+TVSRRS+P+SRT LNGEQP Sbjct: 41 IPTPTADRDRTVSRRSEPNSRTALNGEQP 69 >gb|EXX41465.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 25681_3] Length = 122 Score = 63.5 bits (153), Expect(2) = 2e-17 Identities = 31/44 (70%), Positives = 34/44 (77%) Frame = +2 Query: 137 MLSAVIPSVHSYPAAPLARRQVHQRYVQPGPLVLGSTPLKFRRP 268 MLSAVIPS HSYPA LA + VHQR+V GPLVLG+ PLKF P Sbjct: 1 MLSAVIPSEHSYPAMRLASQPVHQRFVHSGPLVLGADPLKFPAP 44 Score = 51.2 bits (121), Expect(2) = 2e-17 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = +1 Query: 265 PTADRDQTVSRRSKPSSRTTLNGEQP 342 PT DRD+TVSRRSKPSSRT+LNGEQP Sbjct: 44 PTVDRDRTVSRRSKPSSRTSLNGEQP 69 >gb|EXT02985.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 45002_8] Length = 122 Score = 63.5 bits (153), Expect(2) = 2e-17 Identities = 31/44 (70%), Positives = 34/44 (77%) Frame = +2 Query: 137 MLSAVIPSVHSYPAAPLARRQVHQRYVQPGPLVLGSTPLKFRRP 268 MLSAVIPS HSYPA LA + VHQR+V GPLVLG+ PLKF P Sbjct: 1 MLSAVIPSEHSYPAMRLASQPVHQRFVHSGPLVLGADPLKFPAP 44 Score = 51.2 bits (121), Expect(2) = 2e-17 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = +1 Query: 265 PTADRDQTVSRRSKPSSRTTLNGEQP 342 PT DRD+TVSRRSKPSSRT+LNGEQP Sbjct: 44 PTVDRDRTVSRRSKPSSRTSLNGEQP 69 >gb|EXH74083.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 23671] Length = 122 Score = 63.5 bits (153), Expect(2) = 2e-17 Identities = 31/44 (70%), Positives = 34/44 (77%) Frame = +2 Query: 137 MLSAVIPSVHSYPAAPLARRQVHQRYVQPGPLVLGSTPLKFRRP 268 MLSAVIPS HSYPA LA + VHQR+V GPLVLG+ PLKF P Sbjct: 1 MLSAVIPSEHSYPAMRLASQPVHQRFVHSGPLVLGADPLKFPAP 44 Score = 51.2 bits (121), Expect(2) = 2e-17 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = +1 Query: 265 PTADRDQTVSRRSKPSSRTTLNGEQP 342 PT DRD+TVSRRSKPSSRT+LNGEQP Sbjct: 44 PTVDRDRTVSRRSKPSSRTSLNGEQP 69 >ref|YP_008210737.1| hypothetical protein BJAB07104_03274 [Acinetobacter baumannii BJAB07104] gi|523524686|ref|YP_008210765.1| hypothetical protein BJAB07104_03303 [Acinetobacter baumannii BJAB07104] gi|523529122|ref|YP_008215149.1| hypothetical protein BJAB0715_00001 [Acinetobacter baumannii BJAB0715] gi|523529175|ref|YP_008215202.1| hypothetical protein BJAB0715_00054 [Acinetobacter baumannii BJAB0715] gi|523529341|ref|YP_008215368.1| hypothetical protein BJAB0715_00220 [Acinetobacter baumannii BJAB0715] gi|523529790|ref|YP_008215817.1| hypothetical protein BJAB0715_00669 [Acinetobacter baumannii BJAB0715] gi|523532457|ref|YP_008218484.1| hypothetical protein BJAB0715_03336 [Acinetobacter baumannii BJAB0715] gi|523532488|ref|YP_008218515.1| hypothetical protein BJAB0715_03367 [Acinetobacter baumannii BJAB0715] gi|487914737|ref|WP_001988203.1| hydrolase [Acinetobacter] gi|213986274|gb|ACJ56573.1| hypothetical protein ABBFA_003495 [Acinetobacter baumannii AB307-0294] gi|213986704|gb|ACJ57003.1| hypothetical protein ABBFA_000018 [Acinetobacter baumannii AB307-0294] gi|213987713|gb|ACJ58012.1| hypothetical protein ABBFA_003346 [Acinetobacter baumannii AB307-0294] gi|213987736|gb|ACJ58035.1| hypothetical protein ABBFA_000530 [Acinetobacter baumannii AB307-0294] gi|213987997|gb|ACJ58296.1| hypothetical protein ABBFA_000501 [Acinetobacter baumannii AB307-0294] gi|213988906|gb|ACJ59205.1| hypothetical protein ABBFA_002935 [Acinetobacter baumannii AB307-0294] gi|262300306|gb|EEY88218.1| hypothetical protein HMPREF0018_00965 [Acinetobacter radioresistens SH164] gi|332737690|gb|EGJ68585.1| hypothetical protein HMPREF0022_01653 [Acinetobacter baumannii 6014059] gi|400206219|gb|EJO37198.1| hypothetical protein ACINWCA157_1046 [Acinetobacter radioresistens WC-A-157] gi|404558746|gb|EKA64024.1| hypothetical protein ACINIS143_3496 [Acinetobacter baumannii IS-143] gi|404560243|gb|EKA65488.1| hypothetical protein ACINIS116_3360 [Acinetobacter baumannii IS-116] gi|404562705|gb|EKA67924.1| hypothetical protein ACINIS116_3390 [Acinetobacter baumannii IS-116] gi|404562820|gb|EKA68035.1| hypothetical protein ACINIS143_3968 [Acinetobacter baumannii IS-143] gi|404564303|gb|EKA69485.1| hypothetical protein ACINIS143_0246 [Acinetobacter baumannii IS-143] gi|404564589|gb|EKA69768.1| hypothetical protein ACINIS116_3856 [Acinetobacter baumannii IS-116] gi|404565552|gb|EKA70718.1| hypothetical protein ACINIS143_0685 [Acinetobacter baumannii IS-143] gi|404565598|gb|EKA70762.1| hypothetical protein ACINIS116_0212 [Acinetobacter baumannii IS-116] gi|404569526|gb|EKA74612.1| hypothetical protein ACINIS143_3466 [Acinetobacter baumannii IS-143] gi|404570102|gb|EKA75180.1| hypothetical protein ACINIS58_3418 [Acinetobacter baumannii IS-58] gi|404571699|gb|EKA76750.1| hypothetical protein ACINIS58_0208 [Acinetobacter baumannii IS-58] gi|404572809|gb|EKA77851.1| hypothetical protein ACINIS58_3911 [Acinetobacter baumannii IS-58] gi|404573312|gb|EKA78350.1| hypothetical protein ACINIS58_0056 [Acinetobacter baumannii IS-58] gi|404573383|gb|EKA78418.1| hypothetical protein ACINIS58_3449 [Acinetobacter baumannii IS-58] gi|408504660|gb|EKK06401.1| hypothetical protein ACINIS235_0201 [Acinetobacter baumannii IS-235] gi|408512464|gb|EKK14106.1| hypothetical protein ACINIS235_0052 [Acinetobacter baumannii IS-235] gi|408513402|gb|EKK15021.1| hypothetical protein ACINIS235_3424 [Acinetobacter baumannii IS-235] gi|408514449|gb|EKK16055.1| hypothetical protein ACINIS235_3883 [Acinetobacter baumannii IS-235] gi|408515217|gb|EKK16806.1| hypothetical protein ACINIS235_3392 [Acinetobacter baumannii IS-235] gi|410378578|gb|EKP31189.1| hypothetical protein ACIN5099_3257 [Acinetobacter baumannii OIFC099] gi|410380809|gb|EKP33385.1| hypothetical protein ACIN5099_0055 [Acinetobacter baumannii OIFC099] gi|410383555|gb|EKP36085.1| hypothetical protein ACIN5099_0687 [Acinetobacter baumannii OIFC099] gi|410384450|gb|EKP36959.1| hypothetical protein ACIN5099_0209 [Acinetobacter baumannii OIFC099] gi|410385608|gb|EKP38096.1| hypothetical protein ACIN5099_3292 [Acinetobacter baumannii OIFC099] gi|410413598|gb|EKP65413.1| hypothetical protein ACIN5035_3304 [Acinetobacter baumannii OIFC035] gi|410414078|gb|EKP65885.1| hypothetical protein ACIN5035_0683 [Acinetobacter baumannii OIFC035] gi|410415206|gb|EKP66997.1| hypothetical protein ACIN5035_0052 [Acinetobacter baumannii OIFC035] gi|410415995|gb|EKP67772.1| hypothetical protein ACIN5035_3340 [Acinetobacter baumannii OIFC035] gi|410416986|gb|EKP68757.1| hypothetical protein ACIN5035_3822 [Acinetobacter baumannii OIFC035] gi|410417719|gb|EKP69488.1| hypothetical protein ACIN5035_0207 [Acinetobacter baumannii OIFC035] gi|425496412|gb|EKU62542.1| hypothetical protein ACINNAV113_3619 [Acinetobacter baumannii Naval-113] gi|425497388|gb|EKU63494.1| hypothetical protein ACINNAV113_4085 [Acinetobacter baumannii Naval-113] gi|425497897|gb|EKU63987.1| hypothetical protein ACINNAV113_0055 [Acinetobacter baumannii Naval-113] gi|425498843|gb|EKU64909.1| hypothetical protein ACINNAV113_0715 [Acinetobacter baumannii Naval-113] gi|425696948|gb|EKU66641.1| hypothetical protein ACINWC136_0224 [Acinetobacter baumannii WC-136] gi|425697354|gb|EKU67036.1| hypothetical protein ACINWC136_0056 [Acinetobacter baumannii WC-136] gi|425698014|gb|EKU67661.1| hypothetical protein ACINWC136_4089 [Acinetobacter baumannii WC-136] gi|425698645|gb|EKU68279.1| hypothetical protein ACINWC136_3562 [Acinetobacter baumannii WC-136] gi|444780641|gb|ELX04581.1| hypothetical protein ACINNAV57_3370 [Acinetobacter baumannii Naval-57] gi|444782758|gb|ELX06634.1| hypothetical protein ACINNAV57_3827 [Acinetobacter baumannii Naval-57] gi|444782964|gb|ELX06832.1| hypothetical protein ACINNAV57_3339 [Acinetobacter baumannii Naval-57] gi|444784094|gb|ELX07925.1| hypothetical protein ACINNAV57_0209 [Acinetobacter baumannii Naval-57] gi|480041956|gb|ENV81378.1| hypothetical protein F941_03209 [Acinetobacter bouvetii DSM 14964 = CIP 107468] gi|480042515|gb|ENV81907.1| hypothetical protein F941_02726 [Acinetobacter bouvetii DSM 14964 = CIP 107468] gi|480046710|gb|ENV85889.1| hypothetical protein F940_01649 [Acinetobacter radioresistens NIPH 2130] gi|522327839|gb|AGQ15642.1| hypothetical protein BJAB07104_03274 [Acinetobacter baumannii BJAB07104] gi|522327867|gb|AGQ15670.1| hypothetical protein BJAB07104_03303 [Acinetobacter baumannii BJAB07104] gi|522368384|gb|AGQ04647.1| hypothetical protein BJAB0715_00001 [Acinetobacter baumannii BJAB0715] gi|522368437|gb|AGQ04700.1| hypothetical protein BJAB0715_00054 [Acinetobacter baumannii BJAB0715] gi|522368603|gb|AGQ04866.1| hypothetical protein BJAB0715_00220 [Acinetobacter baumannii BJAB0715] gi|522369052|gb|AGQ05315.1| hypothetical protein BJAB0715_00669 [Acinetobacter baumannii BJAB0715] gi|522371719|gb|AGQ07982.1| hypothetical protein BJAB0715_03336 [Acinetobacter baumannii BJAB0715] gi|522371750|gb|AGQ08013.1| hypothetical protein BJAB0715_03367 [Acinetobacter baumannii BJAB0715] gi|546200762|dbj|BAN86005.1| 23S ribosomal RNA [Acinetobacter baumannii NCGM 237] gi|546201172|dbj|BAN86415.1| 23S ribosomal RNA [Acinetobacter baumannii NCGM 237] gi|546201204|dbj|BAN86447.1| 23S ribosomal RNA [Acinetobacter baumannii NCGM 237] gi|546203523|dbj|BAN88766.1| 23S ribosomal RNA [Acinetobacter baumannii NCGM 237] gi|546203934|dbj|BAN89177.1| 23S ribosomal RNA [Acinetobacter baumannii NCGM 237] gi|546204083|dbj|BAN89326.1| 23S ribosomal RNA [Acinetobacter baumannii NCGM 237] gi|572037514|gb|ETR91237.1| putative cell wall-associated hydrolase [Acinetobacter baumannii CI77] gi|572038448|gb|ETR92139.1| putative cell wall-associated hydrolase [Acinetobacter baumannii CI77] gi|572038496|gb|ETR92181.1| putative cell wall-associated hydrolase [Acinetobacter baumannii CI77] gi|587784560|gb|EXA77652.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 1202252] gi|587789137|gb|EXA82082.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 1202252] gi|587816010|gb|EXB07597.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 1397084] gi|587816018|gb|EXB07603.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 1397084] gi|587816309|gb|EXB07877.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 1396970] gi|587817110|gb|EXB08523.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 1396970] gi|587817677|gb|EXB09023.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 1397084] gi|587818299|gb|EXB09591.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 1396970] gi|587819420|gb|EXB10646.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 1396970] gi|587819808|gb|EXB11015.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 1397084] gi|587820653|gb|EXB11818.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 1396970] gi|587821162|gb|EXB12303.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 1396970] gi|587822486|gb|EXB13575.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 1397084] gi|587838104|gb|EXB28822.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 1419130] gi|587843268|gb|EXB33839.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 1419130] gi|587843916|gb|EXB34479.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 1419130] gi|587878406|gb|EXB67409.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 230853] gi|587878685|gb|EXB67678.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 230853] gi|587879316|gb|EXB68289.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 230853] gi|587879632|gb|EXB68596.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 230853] gi|587880477|gb|EXB69429.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 230853] gi|587881589|gb|EXB70524.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 230853] gi|587883835|gb|EXB72741.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 230853] gi|587884416|gb|EXB73307.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 230853] gi|587887040|gb|EXB75801.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 272263] gi|587896130|gb|EXB84618.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 299505] gi|587897012|gb|EXB85488.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 299505] gi|587897840|gb|EXB86305.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 272263] gi|587900603|gb|EXB88905.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 400834] gi|587901205|gb|EXB89486.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 400834] gi|587907140|gb|EXB95163.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 400834] gi|587907312|gb|EXB95323.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 400834] gi|587909142|gb|EXB97063.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 400834] gi|587910021|gb|EXB97912.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 400834] gi|587946048|gb|EXC32406.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 869535] gi|587961405|gb|EXC46668.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 1032241] gi|587962221|gb|EXC47448.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 1032241] gi|587962481|gb|EXC47699.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 1032241] gi|587965104|gb|EXC50262.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 99063] gi|587967444|gb|EXC52490.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 99063] gi|587968826|gb|EXC53833.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 1032241] gi|587972180|gb|EXC57037.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 1036938] gi|587979931|gb|EXC64518.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 1036938] gi|587985819|gb|EXC70231.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 1036938] gi|587994897|gb|EXC78762.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 1046051] gi|587998188|gb|EXC81943.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 1043903] gi|588003442|gb|EXC87053.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 1051176] gi|588068962|gb|EXD50025.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 564012] gi|588130388|gb|EXE06492.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 1277411] gi|588132136|gb|EXE08192.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 1277411] gi|588134297|gb|EXE10248.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 1277411] gi|588136076|gb|EXE11942.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 1277411] gi|588160752|gb|EXE35241.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 1546444] gi|588160904|gb|EXE35386.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 1546444] gi|588180301|gb|EXE54109.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 1552865] gi|588180713|gb|EXE54509.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 1552865] gi|588182414|gb|EXE56164.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 1552865] gi|588182739|gb|EXE56478.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 1552865] gi|588190471|gb|EXE64125.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 1552865] gi|588191486|gb|EXE65082.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 1552865] gi|589150733|gb|EXF96770.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 1552389] gi|589150782|gb|EXF96809.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 1488685] gi|589151516|gb|EXF97474.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 1552389] gi|589151811|gb|EXF97756.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 1552389] gi|589152391|gb|EXF98316.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 1488685] gi|589152821|gb|EXF98734.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 1488685] gi|589153553|gb|EXF99449.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 1552389] gi|589176455|gb|EXG21786.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 323408] gi|589178793|gb|EXG24099.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 323408] gi|589181458|gb|EXG26691.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 323408] gi|589183455|gb|EXG28630.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 323408] gi|589446954|gb|EXH29661.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 1207552] gi|589451534|gb|EXH34079.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 1207552] gi|589454387|gb|EXH36769.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 1207552] gi|589493860|gb|EXH74685.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 273929] gi|589495004|gb|EXH75771.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 23671] gi|589495083|gb|EXH75847.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 23671] gi|589497850|gb|EXH78551.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 23671] gi|589498790|gb|EXH79478.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 23671] gi|589500429|gb|EXH81063.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 273929] gi|589505742|gb|EXH86253.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 2887] gi|589506581|gb|EXH87056.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 2887] gi|589537265|gb|EXI16924.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 737393] gi|593498403|gb|EXQ84249.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 11126] gi|593501161|gb|EXQ86861.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 11126] gi|593501661|gb|EXQ87344.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 11126] gi|593505814|gb|EXQ91373.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 11126] gi|593594847|gb|EXR76949.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 339786] gi|593612007|gb|EXR93517.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 145660] gi|593612142|gb|EXR93636.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 145660] gi|593615915|gb|EXR97240.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 145660] gi|593626605|gb|EXS07468.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 628418] gi|593629544|gb|EXS10216.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 628418] gi|593632231|gb|EXS12783.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 628418] gi|593640701|gb|EXS20972.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 730795] gi|593645855|gb|EXS25922.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 730795] gi|593660807|gb|EXS40417.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 213697] gi|593661247|gb|EXS40806.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 213697] gi|593664121|gb|EXS43527.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 213697] gi|593664471|gb|EXS43864.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 213697] gi|593667303|gb|EXS46597.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 88816] gi|593682460|gb|EXS60956.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 70136] gi|593684085|gb|EXS62541.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 70136] gi|593813418|gb|EXS72437.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 45002_7] gi|593813875|gb|EXS72855.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 45002_7] gi|593815030|gb|EXS73955.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 45002_7] gi|593819509|gb|EXS78302.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 45002_6] gi|593820663|gb|EXS79412.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 45002_5] gi|593822892|gb|EXS81552.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 45002_5] gi|593822986|gb|EXS81642.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 45002_5] gi|593824181|gb|EXS82795.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 45002_4] gi|593824709|gb|EXS83308.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 45002_5] gi|593825748|gb|EXS84329.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 45002_4] gi|593827546|gb|EXS86042.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 45002_4] gi|593827755|gb|EXS86241.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 45002_4] gi|593830456|gb|EXS88871.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 45002_3] gi|593830711|gb|EXS89104.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 45002_8] gi|593831800|gb|EXS90133.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 45002_3] gi|593831959|gb|EXS90287.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 45002_3] gi|593832652|gb|EXS90951.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 45002_10] gi|593834782|gb|EXS92972.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 45002_8] gi|593834790|gb|EXS92978.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 45002_10] gi|593835086|gb|EXS93246.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 45002_10] gi|593835209|gb|EXS93358.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 45002_8] gi|593835624|gb|EXS93741.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 45002_10] gi|593836184|gb|EXS94267.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 45002_10] gi|593837613|gb|EXS95629.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 45002_10] gi|593943369|gb|EXT96999.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 25253_7] gi|593945204|gb|EXT98753.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 25253_7] gi|593945908|gb|EXT99437.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 25253_7] gi|593946605|gb|EXU00119.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 25253_7] gi|595192612|gb|EXW15876.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 25766_4] gi|595196092|gb|EXW19255.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 25766_4] gi|595214898|gb|EXW37188.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 44327_6] gi|595215304|gb|EXW37584.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 44327_6] gi|595215935|gb|EXW38153.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 44327_6] gi|595216078|gb|EXW38282.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 44327_6] gi|595218228|gb|EXW40302.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 44327_6] gi|595318630|gb|EXX35894.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 25681_3] gi|595321340|gb|EXX38543.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 25681_3] gi|598592877|gb|EYD40136.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 25493_5] gi|598594523|gb|EYD41648.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 25493_5] gi|598599365|gb|EYD46279.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 25493_5] gi|601418520|gb|EYS66810.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 16553_4] gi|601419034|gb|EYS67310.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 16553_4] gi|602187311|gb|EYT16489.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 655378] gi|602203541|gb|EYT32573.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 1121032] gi|604706855|gb|EYU51770.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 1428368] gi|604707150|gb|EYU52059.1| putative cell wall-associated hydrolase [Acinetobacter baumannii 1428368] Length = 122 Score = 63.5 bits (153), Expect(2) = 2e-17 Identities = 31/44 (70%), Positives = 34/44 (77%) Frame = +2 Query: 137 MLSAVIPSVHSYPAAPLARRQVHQRYVQPGPLVLGSTPLKFRRP 268 MLSAVIPS HSYPA LA + VHQR+V GPLVLG+ PLKF P Sbjct: 1 MLSAVIPSEHSYPAMRLASQPVHQRFVHSGPLVLGADPLKFPAP 44 Score = 51.2 bits (121), Expect(2) = 2e-17 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = +1 Query: 265 PTADRDQTVSRRSKPSSRTTLNGEQP 342 PT DRD+TVSRRSKPSSRT+LNGEQP Sbjct: 44 PTVDRDRTVSRRSKPSSRTSLNGEQP 69 >gb|EXC83814.1| putative cell wall-associated hydrolase, partial [Acinetobacter baumannii 1043903] Length = 120 Score = 63.5 bits (153), Expect(2) = 2e-17 Identities = 31/44 (70%), Positives = 34/44 (77%) Frame = +2 Query: 137 MLSAVIPSVHSYPAAPLARRQVHQRYVQPGPLVLGSTPLKFRRP 268 MLSAVIPS HSYPA LA + VHQR+V GPLVLG+ PLKF P Sbjct: 1 MLSAVIPSEHSYPAMRLASQPVHQRFVHSGPLVLGADPLKFPAP 44 Score = 51.2 bits (121), Expect(2) = 2e-17 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = +1 Query: 265 PTADRDQTVSRRSKPSSRTTLNGEQP 342 PT DRD+TVSRRSKPSSRT+LNGEQP Sbjct: 44 PTVDRDRTVSRRSKPSSRTSLNGEQP 69 >gb|EXC73208.1| putative cell wall-associated hydrolase, partial [Acinetobacter baumannii 1043903] Length = 114 Score = 63.5 bits (153), Expect(2) = 2e-17 Identities = 31/44 (70%), Positives = 34/44 (77%) Frame = +2 Query: 137 MLSAVIPSVHSYPAAPLARRQVHQRYVQPGPLVLGSTPLKFRRP 268 MLSAVIPS HSYPA LA + VHQR+V GPLVLG+ PLKF P Sbjct: 1 MLSAVIPSEHSYPAMRLASQPVHQRFVHSGPLVLGADPLKFPAP 44 Score = 51.2 bits (121), Expect(2) = 2e-17 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = +1 Query: 265 PTADRDQTVSRRSKPSSRTTLNGEQP 342 PT DRD+TVSRRSKPSSRT+LNGEQP Sbjct: 44 PTVDRDRTVSRRSKPSSRTSLNGEQP 69 >gb|EXC78953.1| putative cell wall-associated hydrolase, partial [Acinetobacter baumannii 1043903] Length = 107 Score = 63.5 bits (153), Expect(2) = 2e-17 Identities = 31/44 (70%), Positives = 34/44 (77%) Frame = +2 Query: 137 MLSAVIPSVHSYPAAPLARRQVHQRYVQPGPLVLGSTPLKFRRP 268 MLSAVIPS HSYPA LA + VHQR+V GPLVLG+ PLKF P Sbjct: 1 MLSAVIPSEHSYPAMRLASQPVHQRFVHSGPLVLGADPLKFPAP 44 Score = 51.2 bits (121), Expect(2) = 2e-17 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = +1 Query: 265 PTADRDQTVSRRSKPSSRTTLNGEQP 342 PT DRD+TVSRRSKPSSRT+LNGEQP Sbjct: 44 PTVDRDRTVSRRSKPSSRTSLNGEQP 69 >gb|EXC76937.1| putative cell wall-associated hydrolase, partial [Acinetobacter baumannii 1046674] Length = 97 Score = 63.5 bits (153), Expect(2) = 2e-17 Identities = 31/44 (70%), Positives = 34/44 (77%) Frame = +2 Query: 137 MLSAVIPSVHSYPAAPLARRQVHQRYVQPGPLVLGSTPLKFRRP 268 MLSAVIPS HSYPA LA + VHQR+V GPLVLG+ PLKF P Sbjct: 1 MLSAVIPSEHSYPAMRLASQPVHQRFVHSGPLVLGADPLKFPAP 44 Score = 51.2 bits (121), Expect(2) = 2e-17 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = +1 Query: 265 PTADRDQTVSRRSKPSSRTTLNGEQP 342 PT DRD+TVSRRSKPSSRT+LNGEQP Sbjct: 44 PTVDRDRTVSRRSKPSSRTSLNGEQP 69