BLASTX nr result
ID: Akebia24_contig00007701
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00007701 (245 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006849632.1| hypothetical protein AMTR_s00024p00219730 [A... 60 3e-07 >ref|XP_006849632.1| hypothetical protein AMTR_s00024p00219730 [Amborella trichopoda] gi|548853207|gb|ERN11213.1| hypothetical protein AMTR_s00024p00219730 [Amborella trichopoda] Length = 873 Score = 60.1 bits (144), Expect = 3e-07 Identities = 35/81 (43%), Positives = 46/81 (56%), Gaps = 1/81 (1%) Frame = +1 Query: 1 VPAGRLVPSLLPPIDLVQNSE-KRINFVRTIESTPCVNVDVENFDDFGIDLYPTMGTSLL 177 VP G+ P +LP ID V+N +R NF + S N+D +NFDDFG+DLY SLL Sbjct: 75 VPTGKSNPVVLPCIDTVENQVIERFNFDASPGSPSFANMDADNFDDFGVDLYSAPVPSLL 134 Query: 178 DYDSDVDKMNCISNGKADNLV 240 + DSD + N + A N V Sbjct: 135 ETDSDEVERNSTTKRNAANEV 155