BLASTX nr result
ID: Akebia24_contig00007697
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00007697 (351 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK41721.1| unknown [Lotus japonicus] 67 3e-09 gb|AAM88397.1|AF525880_1 cysteine proteinase inhibitor [Colocasi... 66 6e-09 ref|XP_004511090.1| PREDICTED: cysteine proteinase inhibitor 12-... 65 8e-09 ref|NP_001237734.1| cysteine proteinase inhibitor precursor [Gly... 65 1e-08 gb|ACU24145.1| unknown [Glycine max] 65 1e-08 ref|XP_007133641.1| hypothetical protein PHAVU_011G196600g [Phas... 64 3e-08 ref|XP_006836222.1| hypothetical protein AMTR_s00101p00100170 [A... 64 3e-08 ref|XP_003633519.1| PREDICTED: cysteine proteinase inhibitor 12-... 64 3e-08 emb|CBI35059.3| unnamed protein product [Vitis vinifera] 64 3e-08 ref|XP_002267841.1| PREDICTED: cysteine proteinase inhibitor 12-... 64 3e-08 ref|XP_007010774.1| Cysteine proteinase inhibitor 12 [Theobroma ... 63 5e-08 ref|XP_004165517.1| PREDICTED: cysteine proteinase inhibitor 12-... 62 8e-08 ref|XP_004147084.1| PREDICTED: cysteine proteinase inhibitor 12-... 62 8e-08 gb|EXB62705.1| Cysteine proteinase inhibitor 12 [Morus notabilis] 62 1e-07 ref|NP_001237443.1| uncharacterized protein LOC100499887 precurs... 62 1e-07 ref|XP_007220532.1| hypothetical protein PRUPE_ppa010412mg [Prun... 61 1e-07 gb|AAO19652.1| cysteine protease inhibitor cystatin [Malus domes... 61 1e-07 ref|XP_003628013.1| Cysteine proteinase inhibitor [Medicago trun... 61 2e-07 ref|XP_006407331.1| hypothetical protein EUTSA_v10021442mg [Eutr... 60 3e-07 gb|ABB89766.1| At3g12490-like protein [Boechera stricta] 60 3e-07 >gb|AFK41721.1| unknown [Lotus japonicus] Length = 237 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/37 (78%), Positives = 35/37 (94%) Frame = +1 Query: 1 DILLKVKRGSKEEKYKVEVHKTHEGTYHLNQMEQDHS 111 +ILLK+KRG KEEK+KVEVHK +EG++HLNQMEQDHS Sbjct: 201 NILLKLKRGEKEEKFKVEVHKNNEGSFHLNQMEQDHS 237 >gb|AAM88397.1|AF525880_1 cysteine proteinase inhibitor [Colocasia esculenta] Length = 205 Score = 65.9 bits (159), Expect = 6e-09 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = +1 Query: 4 ILLKVKRGSKEEKYKVEVHKTHEGTYHLNQMEQDHS 111 +LLK+KRGS+EEK+KVEVHK EGT+HLNQMEQDHS Sbjct: 166 LLLKLKRGSREEKFKVEVHKNIEGTFHLNQMEQDHS 201 >ref|XP_004511090.1| PREDICTED: cysteine proteinase inhibitor 12-like [Cicer arietinum] Length = 247 Score = 65.5 bits (158), Expect = 8e-09 Identities = 28/37 (75%), Positives = 35/37 (94%) Frame = +1 Query: 1 DILLKVKRGSKEEKYKVEVHKTHEGTYHLNQMEQDHS 111 ++LLK+KRG+KEEK+KVEVHK +EGT+HLNQME DHS Sbjct: 211 NLLLKLKRGAKEEKFKVEVHKNNEGTFHLNQMEADHS 247 >ref|NP_001237734.1| cysteine proteinase inhibitor precursor [Glycine max] gi|1944319|dbj|BAA19608.1| cysteine proteinase inhibitor [Glycine max] gi|1944342|dbj|BAA19610.1| cysteine proteinase inhibitor [Glycine max] Length = 245 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = +1 Query: 1 DILLKVKRGSKEEKYKVEVHKTHEGTYHLNQMEQDHS 111 ++LLKVKRG KEEK+KVEVHK ++G +HLNQMEQDHS Sbjct: 209 NLLLKVKRGQKEEKFKVEVHKNNQGGFHLNQMEQDHS 245 >gb|ACU24145.1| unknown [Glycine max] Length = 245 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = +1 Query: 1 DILLKVKRGSKEEKYKVEVHKTHEGTYHLNQMEQDHS 111 ++LLKVKRG KEEK+KVEVHK ++G +HLNQMEQDHS Sbjct: 209 NLLLKVKRGQKEEKFKVEVHKNNQGGFHLNQMEQDHS 245 >ref|XP_007133641.1| hypothetical protein PHAVU_011G196600g [Phaseolus vulgaris] gi|561006641|gb|ESW05635.1| hypothetical protein PHAVU_011G196600g [Phaseolus vulgaris] Length = 246 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +1 Query: 1 DILLKVKRGSKEEKYKVEVHKTHEGTYHLNQMEQDHS 111 ++LLKVKRG KEEK+KVEVHK ++G HLNQMEQDHS Sbjct: 210 NLLLKVKRGEKEEKFKVEVHKNNQGELHLNQMEQDHS 246 >ref|XP_006836222.1| hypothetical protein AMTR_s00101p00100170 [Amborella trichopoda] gi|548838722|gb|ERM99075.1| hypothetical protein AMTR_s00101p00100170 [Amborella trichopoda] Length = 206 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +1 Query: 1 DILLKVKRGSKEEKYKVEVHKTHEGTYHLNQMEQDHS 111 D+LLK+KRG+KEEKYKVEVHK EG+YHLN M+Q HS Sbjct: 165 DMLLKLKRGNKEEKYKVEVHKNLEGSYHLNHMQQHHS 201 >ref|XP_003633519.1| PREDICTED: cysteine proteinase inhibitor 12-like isoform 2 [Vitis vinifera] Length = 188 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = +1 Query: 1 DILLKVKRGSKEEKYKVEVHKTHEGTYHLNQMEQDHS 111 D+LLKVKRG KEEKYKVEVHK +EG Y LNQM DHS Sbjct: 152 DMLLKVKRGDKEEKYKVEVHKNNEGAYQLNQMAPDHS 188 >emb|CBI35059.3| unnamed protein product [Vitis vinifera] Length = 1204 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = +1 Query: 1 DILLKVKRGSKEEKYKVEVHKTHEGTYHLNQMEQDHS 111 D+LLKVKRG KEEKYKVEVHK +EG Y LNQM DHS Sbjct: 1168 DMLLKVKRGDKEEKYKVEVHKNNEGAYQLNQMAPDHS 1204 >ref|XP_002267841.1| PREDICTED: cysteine proteinase inhibitor 12-like isoform 1 [Vitis vinifera] Length = 201 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = +1 Query: 1 DILLKVKRGSKEEKYKVEVHKTHEGTYHLNQMEQDHS 111 D+LLKVKRG KEEKYKVEVHK +EG Y LNQM DHS Sbjct: 165 DMLLKVKRGDKEEKYKVEVHKNNEGAYQLNQMAPDHS 201 >ref|XP_007010774.1| Cysteine proteinase inhibitor 12 [Theobroma cacao] gi|508727687|gb|EOY19584.1| Cysteine proteinase inhibitor 12 [Theobroma cacao] Length = 239 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +1 Query: 1 DILLKVKRGSKEEKYKVEVHKTHEGTYHLNQMEQDHS 111 D+LLKVKRG KEEK+KVEVH EGT+HLN+ME DHS Sbjct: 203 DMLLKVKRGDKEEKFKVEVHHKSEGTFHLNRMEPDHS 239 >ref|XP_004165517.1| PREDICTED: cysteine proteinase inhibitor 12-like [Cucumis sativus] Length = 202 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +1 Query: 1 DILLKVKRGSKEEKYKVEVHKTHEGTYHLNQMEQDHS 111 D+LLK+KRGSKEEK+KVEVHK +EG + LNQM QDHS Sbjct: 166 DLLLKLKRGSKEEKFKVEVHKNNEGNFLLNQMVQDHS 202 >ref|XP_004147084.1| PREDICTED: cysteine proteinase inhibitor 12-like [Cucumis sativus] Length = 249 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +1 Query: 1 DILLKVKRGSKEEKYKVEVHKTHEGTYHLNQMEQDHS 111 D+LLK+KRGSKEEK+KVEVHK +EG + LNQM QDHS Sbjct: 213 DLLLKLKRGSKEEKFKVEVHKNNEGNFLLNQMVQDHS 249 >gb|EXB62705.1| Cysteine proteinase inhibitor 12 [Morus notabilis] Length = 239 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +1 Query: 1 DILLKVKRGSKEEKYKVEVHKTHEGTYHLNQMEQDHS 111 D++LKVKRG+KEEKYK EVHK EGT+HLNQ+E D S Sbjct: 203 DMILKVKRGTKEEKYKAEVHKNSEGTFHLNQIEPDSS 239 >ref|NP_001237443.1| uncharacterized protein LOC100499887 precursor [Glycine max] gi|255627437|gb|ACU14063.1| unknown [Glycine max] Length = 245 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = +1 Query: 1 DILLKVKRGSKEEKYKVEVHKTHEGTYHLNQMEQDHS 111 ++LLKVKRG KEEK+KVEVHK ++ +HLNQMEQDHS Sbjct: 209 NLLLKVKRGQKEEKFKVEVHKNNQRGFHLNQMEQDHS 245 >ref|XP_007220532.1| hypothetical protein PRUPE_ppa010412mg [Prunus persica] gi|462416994|gb|EMJ21731.1| hypothetical protein PRUPE_ppa010412mg [Prunus persica] Length = 250 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = +1 Query: 1 DILLKVKRGSKEEKYKVEVHKTHEGTYHLNQMEQDHS 111 ++LLK+KRG KEEK+KVEVHK +EGT+ LNQME DHS Sbjct: 214 NMLLKLKRGDKEEKFKVEVHKNNEGTFKLNQMEADHS 250 >gb|AAO19652.1| cysteine protease inhibitor cystatin [Malus domestica] Length = 246 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +1 Query: 1 DILLKVKRGSKEEKYKVEVHKTHEGTYHLNQMEQDHS 111 ++LLKVKRGSKEEK+K EVHK EGT+ LNQME DHS Sbjct: 210 NMLLKVKRGSKEEKFKAEVHKNMEGTFSLNQMEADHS 246 >ref|XP_003628013.1| Cysteine proteinase inhibitor [Medicago truncatula] gi|355522035|gb|AET02489.1| Cysteine proteinase inhibitor [Medicago truncatula] Length = 241 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +1 Query: 1 DILLKVKRGSKEEKYKVEVHKTHEGTYHLNQMEQDHS 111 ++LLKVKRG KEEK+KVEVHK EG +HLNQME D+S Sbjct: 205 NLLLKVKRGQKEEKFKVEVHKNSEGNFHLNQMEADNS 241 >ref|XP_006407331.1| hypothetical protein EUTSA_v10021442mg [Eutrema salsugineum] gi|312282949|dbj|BAJ34340.1| unnamed protein product [Thellungiella halophila] gi|557108477|gb|ESQ48784.1| hypothetical protein EUTSA_v10021442mg [Eutrema salsugineum] Length = 234 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = +1 Query: 1 DILLKVKRGSKEEKYKVEVHKTHEGTYHLNQMEQDH 108 ++LLK+KRG KEEK+KVEVHK HEG HLN MEQ H Sbjct: 198 NMLLKLKRGEKEEKFKVEVHKNHEGVLHLNHMEQHH 233 >gb|ABB89766.1| At3g12490-like protein [Boechera stricta] Length = 231 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = +1 Query: 1 DILLKVKRGSKEEKYKVEVHKTHEGTYHLNQMEQDH 108 ++LLK+KRG KEEK+KVEVHK HEG HLN MEQ H Sbjct: 195 NMLLKLKRGEKEEKFKVEVHKNHEGALHLNHMEQHH 230