BLASTX nr result
ID: Akebia24_contig00007567
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00007567 (324 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527491.1| conserved hypothetical protein [Ricinus comm... 46 5e-06 >ref|XP_002527491.1| conserved hypothetical protein [Ricinus communis] gi|223533131|gb|EEF34889.1| conserved hypothetical protein [Ricinus communis] Length = 101 Score = 45.8 bits (107), Expect(2) = 5e-06 Identities = 29/66 (43%), Positives = 34/66 (51%) Frame = +3 Query: 54 GPQRRHLVILSPS*AGSFRCSVKPA*RGVLRSKNCLTQAFAQVNQLNSQLETGELEFTPN 233 G R LVIL AG RCSVKPA R LRS+N +T AFAQ + G P+ Sbjct: 13 GLGRHQLVILPLPRAGGCRCSVKPASRCALRSRNQVTPAFAQGHIAQLSAWNGRARAQPH 72 Query: 234 RS*PVG 251 + P G Sbjct: 73 QGRPTG 78 Score = 30.0 bits (66), Expect(2) = 5e-06 Identities = 16/27 (59%), Positives = 18/27 (66%) Frame = +1 Query: 232 TGPSQSESNQRPTTLMPPLRLQVNATD 312 TGP Q RP TLMP LRLQ +AT+ Sbjct: 77 TGPEQ-----RPITLMPLLRLQAHATE 98