BLASTX nr result
ID: Akebia24_contig00006749
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00006749 (270 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFW86835.1| hypothetical protein ZEAMMB73_214691 [Zea mays] 54 2e-18 ref|YP_588284.1| hypothetical protein ZeamMp020 [Zea mays subsp.... 66 6e-09 >gb|AFW86835.1| hypothetical protein ZEAMMB73_214691 [Zea mays] Length = 77 Score = 53.9 bits (128), Expect(3) = 2e-18 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = -1 Query: 150 SEPPIEASEVGEPYDGQLSPAVRRGLS 70 + PP+EASEVGEPYDGQLSPAVRRGLS Sbjct: 50 ASPPLEASEVGEPYDGQLSPAVRRGLS 76 Score = 45.8 bits (107), Expect(3) = 2e-18 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -2 Query: 197 NPFVEPCIVSDPNLPGASPP 138 NPFV PCIVSDPNLPGASPP Sbjct: 34 NPFVGPCIVSDPNLPGASPP 53 Score = 38.1 bits (87), Expect(3) = 2e-18 Identities = 20/26 (76%), Positives = 22/26 (84%) Frame = -3 Query: 268 FSLRLLGSFFVSTKRKRIILKTLLTP 191 FS+ +GSFFVSTK KRIILKTLL P Sbjct: 11 FSIEKMGSFFVSTK-KRIILKTLLNP 35 >ref|YP_588284.1| hypothetical protein ZeamMp020 [Zea mays subsp. mays] gi|94502700|ref|YP_588308.1| hypothetical protein ZeamMp046 [Zea mays subsp. mays] gi|40795138|gb|AAR91182.1| hypothetical protein (mitochondrion) [Zea mays] gi|40795139|gb|AAR91183.1| hypothetical protein (mitochondrion) [Zea mays] Length = 99 Score = 65.9 bits (159), Expect = 6e-09 Identities = 38/64 (59%), Positives = 42/64 (65%), Gaps = 2/64 (3%) Frame = -1 Query: 252 WVPFSSRQRGKESY*KRS*PLRRAVYCK*SEP--ARSEPPIEASEVGEPYDGQLSPAVRR 79 WVPFSSRQR + P C S+P + PP+EASEVGEPYDGQLSPAVRR Sbjct: 39 WVPFSSRQRKNHL---ENAPNPFVGPCIVSDPNLPGASPPLEASEVGEPYDGQLSPAVRR 95 Query: 78 GLSC 67 GLSC Sbjct: 96 GLSC 99