BLASTX nr result
ID: Akebia24_contig00006565
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00006565 (1149 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002310610.2| hypothetical protein POPTR_0007s06720g [Popu... 60 1e-06 ref|XP_006464492.1| PREDICTED: probable WRKY transcription facto... 60 2e-06 ref|XP_006427979.1| hypothetical protein CICLE_v10026733mg [Citr... 60 2e-06 gb|AGQ04200.1| WRKY transcription factor 12 [Jatropha curcas] 60 2e-06 ref|XP_007206237.1| hypothetical protein PRUPE_ppa015480mg [Prun... 60 2e-06 gb|AEO31512.1| WRKY transcription factor 16 [Dimocarpus longan] 60 2e-06 ref|XP_002275836.2| PREDICTED: probable WRKY transcription facto... 59 3e-06 emb|CBI21522.3| unnamed protein product [Vitis vinifera] 59 3e-06 ref|XP_007048143.1| WRKY DNA-binding protein 51, putative [Theob... 59 4e-06 ref|XP_002533354.1| WRKY transcription factor, putative [Ricinus... 59 5e-06 ref|XP_007136862.1| hypothetical protein PHAVU_009G080000g [Phas... 58 7e-06 ref|XP_002307134.2| WRKY transcription factor 51 family protein ... 58 7e-06 ref|XP_004288553.1| PREDICTED: probable WRKY transcription facto... 58 7e-06 gb|ACV92018.1| WRKY transcription factor 16 [(Populus tomentosa ... 58 7e-06 >ref|XP_002310610.2| hypothetical protein POPTR_0007s06720g [Populus trichocarpa] gi|550334285|gb|EEE91060.2| hypothetical protein POPTR_0007s06720g [Populus trichocarpa] Length = 190 Score = 60.5 bits (145), Expect = 1e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -2 Query: 1148 SELEIMDDGFKWRKYGKKSVKDSPNPR*FF 1059 SELEIMDDGFKWRKYGKKSVK+SPNPR ++ Sbjct: 95 SELEIMDDGFKWRKYGKKSVKNSPNPRNYY 124 >ref|XP_006464492.1| PREDICTED: probable WRKY transcription factor 51-like [Citrus sinensis] Length = 202 Score = 60.1 bits (144), Expect = 2e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -2 Query: 1148 SELEIMDDGFKWRKYGKKSVKDSPNPR*FF 1059 SELE+MDDGFKWRKYGKKSVK+SPNPR ++ Sbjct: 102 SELEVMDDGFKWRKYGKKSVKNSPNPRNYY 131 >ref|XP_006427979.1| hypothetical protein CICLE_v10026733mg [Citrus clementina] gi|557529969|gb|ESR41219.1| hypothetical protein CICLE_v10026733mg [Citrus clementina] Length = 138 Score = 60.1 bits (144), Expect = 2e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -2 Query: 1148 SELEIMDDGFKWRKYGKKSVKDSPNPR*FF 1059 SELE+MDDGFKWRKYGKKSVK+SPNPR ++ Sbjct: 38 SELEVMDDGFKWRKYGKKSVKNSPNPRNYY 67 >gb|AGQ04200.1| WRKY transcription factor 12 [Jatropha curcas] Length = 201 Score = 60.1 bits (144), Expect = 2e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -2 Query: 1148 SELEIMDDGFKWRKYGKKSVKDSPNPR*FF 1059 SELE+MDDGFKWRKYGKKSVK+SPNPR ++ Sbjct: 107 SELEVMDDGFKWRKYGKKSVKNSPNPRNYY 136 >ref|XP_007206237.1| hypothetical protein PRUPE_ppa015480mg [Prunus persica] gi|462401879|gb|EMJ07436.1| hypothetical protein PRUPE_ppa015480mg [Prunus persica] Length = 196 Score = 60.1 bits (144), Expect = 2e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -2 Query: 1148 SELEIMDDGFKWRKYGKKSVKDSPNPR*FF 1059 SELE+MDDGFKWRKYGKKSVK+SPNPR ++ Sbjct: 101 SELEVMDDGFKWRKYGKKSVKNSPNPRNYY 130 >gb|AEO31512.1| WRKY transcription factor 16 [Dimocarpus longan] Length = 150 Score = 60.1 bits (144), Expect = 2e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -2 Query: 1148 SELEIMDDGFKWRKYGKKSVKDSPNPR*FF 1059 SELE+MDDGFKWRKYGKKSVK+SPNPR ++ Sbjct: 102 SELEVMDDGFKWRKYGKKSVKNSPNPRNYY 131 >ref|XP_002275836.2| PREDICTED: probable WRKY transcription factor 51-like [Vitis vinifera] Length = 149 Score = 59.3 bits (142), Expect = 3e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -2 Query: 1148 SELEIMDDGFKWRKYGKKSVKDSPNPR*FF 1059 S+LEIMDDGFKWRKYGKKSVK+SPNPR ++ Sbjct: 56 SDLEIMDDGFKWRKYGKKSVKNSPNPRNYY 85 >emb|CBI21522.3| unnamed protein product [Vitis vinifera] Length = 193 Score = 59.3 bits (142), Expect = 3e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -2 Query: 1148 SELEIMDDGFKWRKYGKKSVKDSPNPR*FF 1059 S+LEIMDDGFKWRKYGKKSVK+SPNPR ++ Sbjct: 100 SDLEIMDDGFKWRKYGKKSVKNSPNPRNYY 129 >ref|XP_007048143.1| WRKY DNA-binding protein 51, putative [Theobroma cacao] gi|508700404|gb|EOX92300.1| WRKY DNA-binding protein 51, putative [Theobroma cacao] Length = 245 Score = 58.9 bits (141), Expect = 4e-06 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = -2 Query: 1148 SELEIMDDGFKWRKYGKKSVKDSPNPR*FF 1059 SELE+MDDG+KWRKYGKKSVK+SPNPR ++ Sbjct: 152 SELEVMDDGYKWRKYGKKSVKNSPNPRNYY 181 >ref|XP_002533354.1| WRKY transcription factor, putative [Ricinus communis] gi|223526806|gb|EEF29027.1| WRKY transcription factor, putative [Ricinus communis] Length = 215 Score = 58.5 bits (140), Expect = 5e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -2 Query: 1148 SELEIMDDGFKWRKYGKKSVKDSPNPR*FF 1059 SELEIMDDGFKWRKYGKKSVK+SP+PR ++ Sbjct: 113 SELEIMDDGFKWRKYGKKSVKNSPHPRNYY 142 >ref|XP_007136862.1| hypothetical protein PHAVU_009G080000g [Phaseolus vulgaris] gi|561009949|gb|ESW08856.1| hypothetical protein PHAVU_009G080000g [Phaseolus vulgaris] Length = 158 Score = 58.2 bits (139), Expect = 7e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -2 Query: 1148 SELEIMDDGFKWRKYGKKSVKDSPNPR*FF 1059 SE+EIMDDGFKWRKYGKK VK+SPNPR ++ Sbjct: 92 SEIEIMDDGFKWRKYGKKKVKNSPNPRNYY 121 >ref|XP_002307134.2| WRKY transcription factor 51 family protein [Populus trichocarpa] gi|550338424|gb|EEE94130.2| WRKY transcription factor 51 family protein [Populus trichocarpa] Length = 204 Score = 58.2 bits (139), Expect = 7e-06 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = -2 Query: 1148 SELEIMDDGFKWRKYGKKSVKDSPNPR*FF 1059 SELE+MDDGFKWRKYGKKSVK+SP+PR ++ Sbjct: 109 SELEVMDDGFKWRKYGKKSVKNSPHPRNYY 138 >ref|XP_004288553.1| PREDICTED: probable WRKY transcription factor 51-like [Fragaria vesca subsp. vesca] Length = 205 Score = 58.2 bits (139), Expect = 7e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -2 Query: 1148 SELEIMDDGFKWRKYGKKSVKDSPNPR*FF 1059 SELEIMDDGFKWRKYGKK VK+SPNPR ++ Sbjct: 104 SELEIMDDGFKWRKYGKKYVKNSPNPRNYY 133 >gb|ACV92018.1| WRKY transcription factor 16 [(Populus tomentosa x Populus bolleana) x Populus tomentosa] Length = 191 Score = 58.2 bits (139), Expect = 7e-06 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = -2 Query: 1148 SELEIMDDGFKWRKYGKKSVKDSPNPR*FF 1059 S+LEIMDDG+KWRKYGKKSVK+SPNPR ++ Sbjct: 96 SDLEIMDDGYKWRKYGKKSVKNSPNPRNYY 125