BLASTX nr result
ID: Akebia24_contig00004435
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00004435 (464 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002298288.1| hypothetical protein POPTR_0001s22780g [Popu... 57 3e-06 >ref|XP_002298288.1| hypothetical protein POPTR_0001s22780g [Populus trichocarpa] gi|222845546|gb|EEE83093.1| hypothetical protein POPTR_0001s22780g [Populus trichocarpa] Length = 419 Score = 57.0 bits (136), Expect = 3e-06 Identities = 36/82 (43%), Positives = 40/82 (48%) Frame = +3 Query: 15 GTSLNHTGLSPSIASGVLPMVNRSGATAPVGLGTSGVSPYANQSGATPPVGLGVAFGARP 194 G LN TGLSP GV +NR G P +GLG F + Sbjct: 331 GGMLNQTGLSPLFPGGVSQPLNRVGNVGP-------------------SIGLGAGFTTQH 371 Query: 195 AINTISPSVIGSYGSQAALQGL 260 INTIS S+IGSY SQAALQGL Sbjct: 372 GINTISNSMIGSYNSQAALQGL 393