BLASTX nr result
ID: Akebia24_contig00004213
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00004213 (863 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006354774.1| PREDICTED: chlorophyll a-b binding protein 4... 91 4e-16 ref|XP_004241587.1| PREDICTED: chlorophyll a-b binding protein 4... 91 4e-16 ref|XP_003578105.1| PREDICTED: chlorophyll a-b binding protein 4... 91 6e-16 ref|XP_006374464.1| hypothetical protein POPTR_0015s07340g [Popu... 91 7e-16 ref|XP_006374459.1| hypothetical protein POPTR_0015s07340g [Popu... 91 7e-16 ref|XP_006374463.1| Chlorophyll a-b binding protein 4 [Populus t... 91 7e-16 ref|NP_190331.3| chlorophyll a-b binding protein 4 [Arabidopsis ... 90 1e-15 ref|XP_006477466.1| PREDICTED: chlorophyll a-b binding protein P... 90 1e-15 ref|XP_006440616.1| hypothetical protein CICLE_v10021861mg [Citr... 90 1e-15 gb|AAG40364.1|AF325012_1 AT3g47470 [Arabidopsis thaliana] 90 1e-15 ref|XP_004138171.1| PREDICTED: chlorophyll a-b binding protein P... 90 1e-15 gb|ACN40598.1| unknown [Picea sitchensis] 89 2e-15 ref|XP_002514741.1| chlorophyll A/B binding protein, putative [R... 89 2e-15 gb|ACB05669.1| chloroplast chlorophyll a/b binding protein [Caps... 89 2e-15 gb|ABK24236.1| unknown [Picea sitchensis] gi|116790888|gb|ABK257... 89 2e-15 ref|XP_004973512.1| PREDICTED: chlorophyll a-b binding protein P... 89 2e-15 ref|XP_002877563.1| chlorophyll a/b-binding protein [Arabidopsis... 89 2e-15 ref|NP_001150371.1| LOC100284001 [Zea mays] gi|195638726|gb|ACG3... 89 2e-15 gb|ACG35965.1| chlorophyll a-b binding protein 4 [Zea mays] 89 2e-15 gb|ACF86037.1| unknown [Zea mays] gi|195613086|gb|ACG28373.1| ch... 89 2e-15 >ref|XP_006354774.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic-like [Solanum tuberosum] Length = 250 Score = 91.3 bits (225), Expect = 4e-16 Identities = 40/44 (90%), Positives = 44/44 (100%) Frame = -3 Query: 327 GRLAMLAFLGFIVQHNVTGKGPFENLLQHIADPWHNTIVQTFSS 196 GRLAMLAFLGFIVQHNVTGKGPF+NLLQHI+DPWHNTI+QTFS+ Sbjct: 207 GRLAMLAFLGFIVQHNVTGKGPFDNLLQHISDPWHNTIIQTFSN 250 >ref|XP_004241587.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic-like [Solanum lycopersicum] Length = 250 Score = 91.3 bits (225), Expect = 4e-16 Identities = 40/44 (90%), Positives = 44/44 (100%) Frame = -3 Query: 327 GRLAMLAFLGFIVQHNVTGKGPFENLLQHIADPWHNTIVQTFSS 196 GRLAMLAFLGFIVQHNVTGKGPF+NLLQHI+DPWHNTI+QTFS+ Sbjct: 207 GRLAMLAFLGFIVQHNVTGKGPFDNLLQHISDPWHNTIIQTFSN 250 >ref|XP_003578105.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic-like [Brachypodium distachyon] Length = 246 Score = 90.9 bits (224), Expect = 6e-16 Identities = 39/43 (90%), Positives = 43/43 (100%) Frame = -3 Query: 327 GRLAMLAFLGFIVQHNVTGKGPFENLLQHIADPWHNTIVQTFS 199 GRLAMLAFLGF+VQHNVTGKGPFENL+QH+ADPWHNTI+QTFS Sbjct: 203 GRLAMLAFLGFLVQHNVTGKGPFENLMQHLADPWHNTIIQTFS 245 >ref|XP_006374464.1| hypothetical protein POPTR_0015s07340g [Populus trichocarpa] gi|550322228|gb|ERP52261.1| hypothetical protein POPTR_0015s07340g [Populus trichocarpa] Length = 252 Score = 90.5 bits (223), Expect = 7e-16 Identities = 39/43 (90%), Positives = 43/43 (100%) Frame = -3 Query: 327 GRLAMLAFLGFIVQHNVTGKGPFENLLQHIADPWHNTIVQTFS 199 GRLAMLAFLGF++QHNVTGKGPF+NLLQHI+DPWHNTIVQTFS Sbjct: 207 GRLAMLAFLGFVIQHNVTGKGPFDNLLQHISDPWHNTIVQTFS 249 >ref|XP_006374459.1| hypothetical protein POPTR_0015s07340g [Populus trichocarpa] gi|566206407|ref|XP_006374460.1| hypothetical protein POPTR_0015s07340g [Populus trichocarpa] gi|550322223|gb|ERP52256.1| hypothetical protein POPTR_0015s07340g [Populus trichocarpa] gi|550322224|gb|ERP52257.1| hypothetical protein POPTR_0015s07340g [Populus trichocarpa] Length = 150 Score = 90.5 bits (223), Expect = 7e-16 Identities = 39/43 (90%), Positives = 43/43 (100%) Frame = -3 Query: 327 GRLAMLAFLGFIVQHNVTGKGPFENLLQHIADPWHNTIVQTFS 199 GRLAMLAFLGF++QHNVTGKGPF+NLLQHI+DPWHNTIVQTFS Sbjct: 106 GRLAMLAFLGFVIQHNVTGKGPFDNLLQHISDPWHNTIVQTFS 148 >ref|XP_006374463.1| Chlorophyll a-b binding protein 4 [Populus trichocarpa] gi|118489040|gb|ABK96327.1| unknown [Populus trichocarpa x Populus deltoides] gi|550322227|gb|ERP52260.1| Chlorophyll a-b binding protein 4 [Populus trichocarpa] Length = 251 Score = 90.5 bits (223), Expect = 7e-16 Identities = 39/43 (90%), Positives = 43/43 (100%) Frame = -3 Query: 327 GRLAMLAFLGFIVQHNVTGKGPFENLLQHIADPWHNTIVQTFS 199 GRLAMLAFLGF++QHNVTGKGPF+NLLQHI+DPWHNTIVQTFS Sbjct: 207 GRLAMLAFLGFVIQHNVTGKGPFDNLLQHISDPWHNTIVQTFS 249 >ref|NP_190331.3| chlorophyll a-b binding protein 4 [Arabidopsis thaliana] gi|115385|sp|P27521.1|CA4_ARATH RecName: Full=Chlorophyll a-b binding protein 4, chloroplastic; AltName: Full=LHCI type III CAB-4; Flags: Precursor gi|166646|gb|AAA32760.1| light-harvesting chlorophyll a/b binding protein [Arabidopsis thaliana] gi|6522530|emb|CAB61973.1| CHLOROPHYLL A-B BINDING PROTEIN 4 PRECURSOR homolog [Arabidopsis thaliana] gi|20260362|gb|AAM13079.1| chlorophyll A-B binding protein 4 precursor homolog [Arabidopsis thaliana] gi|21554365|gb|AAM63472.1| chlorophyll a-b binding protein 4 precursor homolog [Arabidopsis thaliana] gi|23197770|gb|AAN15412.1| chlorophyll A-B binding protein 4 precursor homolog [Arabidopsis thaliana] gi|332644764|gb|AEE78285.1| chlorophyll a-b binding protein 4 [Arabidopsis thaliana] Length = 251 Score = 90.1 bits (222), Expect = 1e-15 Identities = 39/43 (90%), Positives = 43/43 (100%) Frame = -3 Query: 327 GRLAMLAFLGFIVQHNVTGKGPFENLLQHIADPWHNTIVQTFS 199 GRLAMLAFLGF+VQHNVTGKGPFENLLQH++DPWHNTIVQTF+ Sbjct: 209 GRLAMLAFLGFVVQHNVTGKGPFENLLQHLSDPWHNTIVQTFN 251 >ref|XP_006477466.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic-like [Citrus sinensis] Length = 250 Score = 90.1 bits (222), Expect = 1e-15 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = -3 Query: 327 GRLAMLAFLGFIVQHNVTGKGPFENLLQHIADPWHNTIVQTFS 199 GRLAMLAFLGFIVQHNVTGKGPFENLLQHI+DPWHNTIVQT S Sbjct: 206 GRLAMLAFLGFIVQHNVTGKGPFENLLQHISDPWHNTIVQTLS 248 >ref|XP_006440616.1| hypothetical protein CICLE_v10021861mg [Citrus clementina] gi|557542878|gb|ESR53856.1| hypothetical protein CICLE_v10021861mg [Citrus clementina] Length = 249 Score = 90.1 bits (222), Expect = 1e-15 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = -3 Query: 327 GRLAMLAFLGFIVQHNVTGKGPFENLLQHIADPWHNTIVQTFS 199 GRLAMLAFLGFIVQHNVTGKGPFENLLQHI+DPWHNTIVQT S Sbjct: 205 GRLAMLAFLGFIVQHNVTGKGPFENLLQHISDPWHNTIVQTLS 247 >gb|AAG40364.1|AF325012_1 AT3g47470 [Arabidopsis thaliana] Length = 148 Score = 90.1 bits (222), Expect = 1e-15 Identities = 39/43 (90%), Positives = 43/43 (100%) Frame = -3 Query: 327 GRLAMLAFLGFIVQHNVTGKGPFENLLQHIADPWHNTIVQTFS 199 GRLAMLAFLGF+VQHNVTGKGPFENLLQH++DPWHNTIVQTF+ Sbjct: 106 GRLAMLAFLGFVVQHNVTGKGPFENLLQHLSDPWHNTIVQTFN 148 >ref|XP_004138171.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic-like [Cucumis sativus] gi|449477217|ref|XP_004154963.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic-like [Cucumis sativus] Length = 252 Score = 89.7 bits (221), Expect = 1e-15 Identities = 40/42 (95%), Positives = 42/42 (100%) Frame = -3 Query: 327 GRLAMLAFLGFIVQHNVTGKGPFENLLQHIADPWHNTIVQTF 202 GRLAMLAFLGFIVQHNVTGKGPF+NLLQHI+DPWHNTIVQTF Sbjct: 208 GRLAMLAFLGFIVQHNVTGKGPFDNLLQHISDPWHNTIVQTF 249 >gb|ACN40598.1| unknown [Picea sitchensis] Length = 251 Score = 89.4 bits (220), Expect = 2e-15 Identities = 38/42 (90%), Positives = 42/42 (100%) Frame = -3 Query: 327 GRLAMLAFLGFIVQHNVTGKGPFENLLQHIADPWHNTIVQTF 202 GRLAMLAFLGF+VQHNVTGKGPFENLLQH++DPWHNTI+QTF Sbjct: 207 GRLAMLAFLGFVVQHNVTGKGPFENLLQHLSDPWHNTIIQTF 248 >ref|XP_002514741.1| chlorophyll A/B binding protein, putative [Ricinus communis] gi|223546345|gb|EEF47847.1| chlorophyll A/B binding protein, putative [Ricinus communis] Length = 251 Score = 89.4 bits (220), Expect = 2e-15 Identities = 37/43 (86%), Positives = 43/43 (100%) Frame = -3 Query: 327 GRLAMLAFLGFIVQHNVTGKGPFENLLQHIADPWHNTIVQTFS 199 GRLAMLAFLGF++QHNVTGKGPF+NLLQH++DPWHNTI+QTFS Sbjct: 207 GRLAMLAFLGFVIQHNVTGKGPFDNLLQHLSDPWHNTIIQTFS 249 >gb|ACB05669.1| chloroplast chlorophyll a/b binding protein [Capsicum annuum] Length = 250 Score = 89.4 bits (220), Expect = 2e-15 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = -3 Query: 327 GRLAMLAFLGFIVQHNVTGKGPFENLLQHIADPWHNTIVQTFSS 196 GRLAMLAFLGFIVQHNVTGKGPF+NLLQH++DPWHNTI+QT SS Sbjct: 206 GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIIQTLSS 249 >gb|ABK24236.1| unknown [Picea sitchensis] gi|116790888|gb|ABK25778.1| unknown [Picea sitchensis] gi|224285609|gb|ACN40523.1| unknown [Picea sitchensis] Length = 251 Score = 89.4 bits (220), Expect = 2e-15 Identities = 38/42 (90%), Positives = 42/42 (100%) Frame = -3 Query: 327 GRLAMLAFLGFIVQHNVTGKGPFENLLQHIADPWHNTIVQTF 202 GRLAMLAFLGF+VQHNVTGKGPFENLLQH++DPWHNTI+QTF Sbjct: 207 GRLAMLAFLGFVVQHNVTGKGPFENLLQHLSDPWHNTIIQTF 248 >ref|XP_004973512.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic-like [Setaria italica] Length = 245 Score = 89.0 bits (219), Expect = 2e-15 Identities = 37/43 (86%), Positives = 43/43 (100%) Frame = -3 Query: 327 GRLAMLAFLGFIVQHNVTGKGPFENLLQHIADPWHNTIVQTFS 199 GRLAMLAFLGF++QHNVTGKGPF+NLLQH++DPWHNTI+QTFS Sbjct: 202 GRLAMLAFLGFLIQHNVTGKGPFDNLLQHLSDPWHNTIIQTFS 244 >ref|XP_002877563.1| chlorophyll a/b-binding protein [Arabidopsis lyrata subsp. lyrata] gi|297323401|gb|EFH53822.1| chlorophyll a/b-binding protein [Arabidopsis lyrata subsp. lyrata] Length = 252 Score = 89.0 bits (219), Expect = 2e-15 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = -3 Query: 327 GRLAMLAFLGFIVQHNVTGKGPFENLLQHIADPWHNTIVQTFS 199 GRLAMLAFLGF+VQHNVTGKGPFENLLQH++DPWHNTIVQT S Sbjct: 210 GRLAMLAFLGFVVQHNVTGKGPFENLLQHLSDPWHNTIVQTLS 252 >ref|NP_001150371.1| LOC100284001 [Zea mays] gi|195638726|gb|ACG38831.1| chlorophyll a-b binding protein 4 [Zea mays] Length = 247 Score = 89.0 bits (219), Expect = 2e-15 Identities = 37/43 (86%), Positives = 43/43 (100%) Frame = -3 Query: 327 GRLAMLAFLGFIVQHNVTGKGPFENLLQHIADPWHNTIVQTFS 199 GRLAMLAFLGF++QHNVTGKGPF+NLLQH++DPWHNTI+QTFS Sbjct: 204 GRLAMLAFLGFLIQHNVTGKGPFDNLLQHLSDPWHNTIIQTFS 246 >gb|ACG35965.1| chlorophyll a-b binding protein 4 [Zea mays] Length = 247 Score = 89.0 bits (219), Expect = 2e-15 Identities = 37/43 (86%), Positives = 43/43 (100%) Frame = -3 Query: 327 GRLAMLAFLGFIVQHNVTGKGPFENLLQHIADPWHNTIVQTFS 199 GRLAMLAFLGF++QHNVTGKGPF+NLLQH++DPWHNTI+QTFS Sbjct: 204 GRLAMLAFLGFLIQHNVTGKGPFDNLLQHLSDPWHNTIIQTFS 246 >gb|ACF86037.1| unknown [Zea mays] gi|195613086|gb|ACG28373.1| chlorophyll a-b binding protein 4 [Zea mays] gi|414870433|tpg|DAA48990.1| TPA: chlorophyll a-b binding protein 4 [Zea mays] Length = 247 Score = 89.0 bits (219), Expect = 2e-15 Identities = 37/43 (86%), Positives = 43/43 (100%) Frame = -3 Query: 327 GRLAMLAFLGFIVQHNVTGKGPFENLLQHIADPWHNTIVQTFS 199 GRLAMLAFLGF++QHNVTGKGPF+NLLQH++DPWHNTI+QTFS Sbjct: 204 GRLAMLAFLGFLIQHNVTGKGPFDNLLQHLSDPWHNTIIQTFS 246