BLASTX nr result
ID: Akebia24_contig00004050
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00004050 (376 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525115.1| ketol-acid reductoisomerase, chloroplast pre... 79 5e-13 ref|XP_006384029.1| ketol-acid reductoisomerase family protein, ... 79 6e-13 ref|XP_006490113.1| PREDICTED: ketol-acid reductoisomerase, chlo... 78 1e-12 ref|XP_006445541.1| hypothetical protein CICLE_v10014720mg [Citr... 78 1e-12 ref|XP_006421672.1| hypothetical protein CICLE_v10004615mg [Citr... 78 1e-12 ref|XP_007048671.1| Ketol-acid reductoisomerase [Theobroma cacao... 78 1e-12 ref|XP_002522568.1| ketol-acid reductoisomerase, chloroplast pre... 78 1e-12 ref|XP_007025399.1| Ketol-acid reductoisomerase isoform 1 [Theob... 77 2e-12 ref|XP_007048672.1| Ketol-acid reductoisomerase [Theobroma cacao... 77 2e-12 ref|NP_001276286.1| ketol-acid reductoisomerase, chloroplastic-l... 77 3e-12 ref|NP_191420.1| ketol-acid reductoisomerase [Arabidopsis thalia... 76 4e-12 ref|XP_006402768.1| hypothetical protein EUTSA_v10005853mg [Eutr... 76 4e-12 ref|XP_006290799.1| hypothetical protein CARUB_v10016904mg [Caps... 76 4e-12 ref|XP_003539967.1| PREDICTED: ketol-acid reductoisomerase, chlo... 76 4e-12 ref|XP_002876470.1| ketol-acid reductoisomerase [Arabidopsis lyr... 76 4e-12 gb|ACU26530.1| acetohydroxyacid isomeroreductase [Glycine max] 76 4e-12 emb|CBI21968.3| unnamed protein product [Vitis vinifera] 76 4e-12 dbj|BAH20088.1| AT3G58610 [Arabidopsis thaliana] 76 4e-12 ref|XP_002280094.1| PREDICTED: ketol-acid reductoisomerase, chlo... 76 4e-12 dbj|BAD94384.1| ketol-acid reductoisomerase [Arabidopsis thaliana] 76 4e-12 >ref|XP_002525115.1| ketol-acid reductoisomerase, chloroplast precursor, putative [Ricinus communis] gi|223535574|gb|EEF37242.1| ketol-acid reductoisomerase, chloroplast precursor, putative [Ricinus communis] Length = 584 Score = 79.3 bits (194), Expect = 5e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -3 Query: 374 DPVHGAIEVCAQLRPTVDISVPPDADFVRPELRQSSN 264 DPVHGAIEVCAQLRPTVDISVPPDADFVRPELRQSSN Sbjct: 548 DPVHGAIEVCAQLRPTVDISVPPDADFVRPELRQSSN 584 >ref|XP_006384029.1| ketol-acid reductoisomerase family protein, partial [Populus trichocarpa] gi|550340306|gb|ERP61826.1| ketol-acid reductoisomerase family protein, partial [Populus trichocarpa] Length = 392 Score = 79.0 bits (193), Expect = 6e-13 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -3 Query: 374 DPVHGAIEVCAQLRPTVDISVPPDADFVRPELRQSSN 264 DPVHGA+EVCAQLRPTVDISVPPDADFVRPELRQSSN Sbjct: 356 DPVHGAVEVCAQLRPTVDISVPPDADFVRPELRQSSN 392 >ref|XP_006490113.1| PREDICTED: ketol-acid reductoisomerase, chloroplastic-like [Citrus sinensis] Length = 583 Score = 77.8 bits (190), Expect = 1e-12 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -3 Query: 374 DPVHGAIEVCAQLRPTVDISVPPDADFVRPELRQSSN 264 DPVHGAIEVCAQLRPTVDISVPPDADFVRPELRQ SN Sbjct: 547 DPVHGAIEVCAQLRPTVDISVPPDADFVRPELRQGSN 583 >ref|XP_006445541.1| hypothetical protein CICLE_v10014720mg [Citrus clementina] gi|567906457|ref|XP_006445542.1| hypothetical protein CICLE_v10014720mg [Citrus clementina] gi|568871604|ref|XP_006488972.1| PREDICTED: ketol-acid reductoisomerase, chloroplastic-like [Citrus sinensis] gi|557548152|gb|ESR58781.1| hypothetical protein CICLE_v10014720mg [Citrus clementina] gi|557548153|gb|ESR58782.1| hypothetical protein CICLE_v10014720mg [Citrus clementina] Length = 583 Score = 77.8 bits (190), Expect = 1e-12 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -3 Query: 374 DPVHGAIEVCAQLRPTVDISVPPDADFVRPELRQSSN 264 DPVHGAIEVCAQLRPTVDISVPPDADFVRPELRQ SN Sbjct: 547 DPVHGAIEVCAQLRPTVDISVPPDADFVRPELRQGSN 583 >ref|XP_006421672.1| hypothetical protein CICLE_v10004615mg [Citrus clementina] gi|557523545|gb|ESR34912.1| hypothetical protein CICLE_v10004615mg [Citrus clementina] Length = 583 Score = 77.8 bits (190), Expect = 1e-12 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -3 Query: 374 DPVHGAIEVCAQLRPTVDISVPPDADFVRPELRQSSN 264 DPVHGAIEVCAQLRPTVDISVPPDADFVRPELRQ SN Sbjct: 547 DPVHGAIEVCAQLRPTVDISVPPDADFVRPELRQGSN 583 >ref|XP_007048671.1| Ketol-acid reductoisomerase [Theobroma cacao] gi|508700932|gb|EOX92828.1| Ketol-acid reductoisomerase [Theobroma cacao] Length = 588 Score = 77.8 bits (190), Expect = 1e-12 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -3 Query: 374 DPVHGAIEVCAQLRPTVDISVPPDADFVRPELRQSSN 264 DPVHGAIEVCAQLRPTVDISVPPDADFVRPELRQS N Sbjct: 552 DPVHGAIEVCAQLRPTVDISVPPDADFVRPELRQSGN 588 >ref|XP_002522568.1| ketol-acid reductoisomerase, chloroplast precursor, putative [Ricinus communis] gi|223538259|gb|EEF39868.1| ketol-acid reductoisomerase, chloroplast precursor, putative [Ricinus communis] Length = 594 Score = 77.8 bits (190), Expect = 1e-12 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -3 Query: 374 DPVHGAIEVCAQLRPTVDISVPPDADFVRPELRQSSN 264 DPVHGAIEVCAQLRPTVDISVPPDADFVRPELRQS N Sbjct: 558 DPVHGAIEVCAQLRPTVDISVPPDADFVRPELRQSGN 594 >ref|XP_007025399.1| Ketol-acid reductoisomerase isoform 1 [Theobroma cacao] gi|508780765|gb|EOY28021.1| Ketol-acid reductoisomerase isoform 1 [Theobroma cacao] Length = 595 Score = 77.0 bits (188), Expect = 2e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -3 Query: 374 DPVHGAIEVCAQLRPTVDISVPPDADFVRPELRQSS 267 DPVHGAIEVCAQLRPTVDISVPPDADFVRPELRQSS Sbjct: 560 DPVHGAIEVCAQLRPTVDISVPPDADFVRPELRQSS 595 >ref|XP_007048672.1| Ketol-acid reductoisomerase [Theobroma cacao] gi|508700933|gb|EOX92829.1| Ketol-acid reductoisomerase [Theobroma cacao] Length = 517 Score = 77.0 bits (188), Expect = 2e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -3 Query: 374 DPVHGAIEVCAQLRPTVDISVPPDADFVRPELRQSS 267 DPVHGAIEVCAQLRPTVDISVPPDADFVRPELRQSS Sbjct: 482 DPVHGAIEVCAQLRPTVDISVPPDADFVRPELRQSS 517 >ref|NP_001276286.1| ketol-acid reductoisomerase, chloroplastic-like [Glycine max] gi|341958461|gb|AEL13846.1| chloroplast acetohydroxy acid isomeroreductase [Glycine max] Length = 587 Score = 76.6 bits (187), Expect = 3e-12 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = -3 Query: 374 DPVHGAIEVCAQLRPTVDISVPPDADFVRPELRQSSN 264 DPVHGAI+VCA+LRPTVDISVPPDADFVRPELRQSSN Sbjct: 551 DPVHGAIKVCAELRPTVDISVPPDADFVRPELRQSSN 587 >ref|NP_191420.1| ketol-acid reductoisomerase [Arabidopsis thaliana] gi|145332887|ref|NP_001078309.1| ketol-acid reductoisomerase [Arabidopsis thaliana] gi|334186086|ref|NP_001190127.1| ketol-acid reductoisomerase [Arabidopsis thaliana] gi|12644387|sp|Q05758.2|ILV5_ARATH RecName: Full=Ketol-acid reductoisomerase, chloroplastic; AltName: Full=Acetohydroxy-acid reductoisomerase; AltName: Full=Alpha-keto-beta-hydroxylacyl reductoisomerase; Flags: Precursor gi|11692838|gb|AAG40022.1|AF324671_1 AT3g58610 [Arabidopsis thaliana] gi|11993867|gb|AAG42917.1|AF329500_1 putative ketol-acid reductoisomerase [Arabidopsis thaliana] gi|402552|emb|CAA49506.1| ketol-acid reductoisomerase [Arabidopsis thaliana] gi|6735378|emb|CAB68199.1| ketol-acid reductoisomerase [Arabidopsis thaliana] gi|17063195|gb|AAL32973.1| AT3g58610/F14P22_200 [Arabidopsis thaliana] gi|17529224|gb|AAL38839.1| putative ketol-acid reductoisomerase [Arabidopsis thaliana] gi|20465493|gb|AAM20206.1| putative ketol-acid reductoisomerase [Arabidopsis thaliana] gi|23397061|gb|AAN31816.1| putative ketol-acid reductoisomerase [Arabidopsis thaliana] gi|23463055|gb|AAN33197.1| At3g58610/F14P22_200 [Arabidopsis thaliana] gi|332646283|gb|AEE79804.1| ketol-acid reductoisomerase [Arabidopsis thaliana] gi|332646284|gb|AEE79805.1| ketol-acid reductoisomerase [Arabidopsis thaliana] gi|332646285|gb|AEE79806.1| ketol-acid reductoisomerase [Arabidopsis thaliana] Length = 591 Score = 76.3 bits (186), Expect = 4e-12 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -3 Query: 374 DPVHGAIEVCAQLRPTVDISVPPDADFVRPELRQSSN 264 DPVHGAIEVCAQLRPTVDISVP DADFVRPELRQSSN Sbjct: 555 DPVHGAIEVCAQLRPTVDISVPADADFVRPELRQSSN 591 >ref|XP_006402768.1| hypothetical protein EUTSA_v10005853mg [Eutrema salsugineum] gi|557103867|gb|ESQ44221.1| hypothetical protein EUTSA_v10005853mg [Eutrema salsugineum] Length = 594 Score = 76.3 bits (186), Expect = 4e-12 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -3 Query: 374 DPVHGAIEVCAQLRPTVDISVPPDADFVRPELRQSSN 264 DPVHGAIEVCAQLRPTVDISVP DADFVRPELRQSSN Sbjct: 558 DPVHGAIEVCAQLRPTVDISVPEDADFVRPELRQSSN 594 >ref|XP_006290799.1| hypothetical protein CARUB_v10016904mg [Capsella rubella] gi|482559506|gb|EOA23697.1| hypothetical protein CARUB_v10016904mg [Capsella rubella] Length = 591 Score = 76.3 bits (186), Expect = 4e-12 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -3 Query: 374 DPVHGAIEVCAQLRPTVDISVPPDADFVRPELRQSSN 264 DPVHGAIEVCAQLRPTVDISVP DADFVRPELRQSSN Sbjct: 555 DPVHGAIEVCAQLRPTVDISVPADADFVRPELRQSSN 591 >ref|XP_003539967.1| PREDICTED: ketol-acid reductoisomerase, chloroplastic-like [Glycine max] Length = 576 Score = 76.3 bits (186), Expect = 4e-12 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -3 Query: 374 DPVHGAIEVCAQLRPTVDISVPPDADFVRPELRQSSN 264 D VHGAIEVCAQLRPTVDISVPPDADFVRPELRQSSN Sbjct: 540 DQVHGAIEVCAQLRPTVDISVPPDADFVRPELRQSSN 576 >ref|XP_002876470.1| ketol-acid reductoisomerase [Arabidopsis lyrata subsp. lyrata] gi|297322308|gb|EFH52729.1| ketol-acid reductoisomerase [Arabidopsis lyrata subsp. lyrata] Length = 594 Score = 76.3 bits (186), Expect = 4e-12 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -3 Query: 374 DPVHGAIEVCAQLRPTVDISVPPDADFVRPELRQSSN 264 DPVHGAIEVCAQLRPTVDISVP DADFVRPELRQSSN Sbjct: 558 DPVHGAIEVCAQLRPTVDISVPADADFVRPELRQSSN 594 >gb|ACU26530.1| acetohydroxyacid isomeroreductase [Glycine max] Length = 587 Score = 76.3 bits (186), Expect = 4e-12 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -3 Query: 374 DPVHGAIEVCAQLRPTVDISVPPDADFVRPELRQSSN 264 D VHGAIEVCAQLRPTVDISVPPDADFVRPELRQSSN Sbjct: 551 DQVHGAIEVCAQLRPTVDISVPPDADFVRPELRQSSN 587 >emb|CBI21968.3| unnamed protein product [Vitis vinifera] Length = 524 Score = 76.3 bits (186), Expect = 4e-12 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -3 Query: 374 DPVHGAIEVCAQLRPTVDISVPPDADFVRPELRQSSN 264 DPVHGAIEVCAQLRPTVDISVP DADFVRPELRQSSN Sbjct: 488 DPVHGAIEVCAQLRPTVDISVPADADFVRPELRQSSN 524 >dbj|BAH20088.1| AT3G58610 [Arabidopsis thaliana] Length = 591 Score = 76.3 bits (186), Expect = 4e-12 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -3 Query: 374 DPVHGAIEVCAQLRPTVDISVPPDADFVRPELRQSSN 264 DPVHGAIEVCAQLRPTVDISVP DADFVRPELRQSSN Sbjct: 555 DPVHGAIEVCAQLRPTVDISVPADADFVRPELRQSSN 591 >ref|XP_002280094.1| PREDICTED: ketol-acid reductoisomerase, chloroplastic [Vitis vinifera] gi|147767264|emb|CAN69003.1| hypothetical protein VITISV_005408 [Vitis vinifera] Length = 588 Score = 76.3 bits (186), Expect = 4e-12 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -3 Query: 374 DPVHGAIEVCAQLRPTVDISVPPDADFVRPELRQSSN 264 DPVHGAIEVCAQLRPTVDISVP DADFVRPELRQSSN Sbjct: 552 DPVHGAIEVCAQLRPTVDISVPADADFVRPELRQSSN 588 >dbj|BAD94384.1| ketol-acid reductoisomerase [Arabidopsis thaliana] Length = 344 Score = 76.3 bits (186), Expect = 4e-12 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -3 Query: 374 DPVHGAIEVCAQLRPTVDISVPPDADFVRPELRQSSN 264 DPVHGAIEVCAQLRPTVDISVP DADFVRPELRQSSN Sbjct: 308 DPVHGAIEVCAQLRPTVDISVPADADFVRPELRQSSN 344