BLASTX nr result
ID: Akebia24_contig00003895
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00003895 (462 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB69304.1| hypothetical protein L484_002862 [Morus notabilis] 58 1e-06 >gb|EXB69304.1| hypothetical protein L484_002862 [Morus notabilis] Length = 575 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = +3 Query: 324 GGMRMYVAVNPKRYRTLKEVGKITMNVRVITSYQLMQVCQ 443 GG+RM++AV KRYR +KEVGKI M+V +I YQ+MQVCQ Sbjct: 297 GGVRMFIAVTIKRYRAVKEVGKIKMSVGIIAYYQVMQVCQ 336