BLASTX nr result
ID: Akebia24_contig00002637
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00002637 (624 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003633791.1| PREDICTED: uncharacterized protein LOC100257... 63 8e-08 >ref|XP_003633791.1| PREDICTED: uncharacterized protein LOC100257639 [Vitis vinifera] Length = 680 Score = 62.8 bits (151), Expect = 8e-08 Identities = 36/58 (62%), Positives = 41/58 (70%), Gaps = 2/58 (3%) Frame = -1 Query: 624 KEKKYNDLKKSGDDELVGSYKKWSDLEDTP--LRQRFPKSSALPNNKWTLSVRSNLPS 457 KEKK KK GDD V S+KK S+L++TP LRQRF K AL NNK TL+VRSNL S Sbjct: 504 KEKKPERFKKLGDDNSVESHKKGSNLDETPTPLRQRFSKPPALSNNKRTLAVRSNLAS 561