BLASTX nr result
ID: Akebia24_contig00001372
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00001372 (353 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007013873.1| Calcium-binding EF-hand family protein [Theo... 65 8e-09 gb|EMT09921.1| Calcineurin subunit B [Aegilops tauschii] 65 1e-08 ref|XP_002271539.1| PREDICTED: calcineurin subunit B isoform 1 [... 62 1e-07 ref|XP_007154864.1| hypothetical protein PHAVU_003G154200g [Phas... 61 1e-07 ref|XP_006453571.1| hypothetical protein CICLE_v10009711mg [Citr... 61 1e-07 gb|EMT15744.1| Calcineurin subunit B [Aegilops tauschii] 61 1e-07 ref|XP_002517685.1| calcineurin B subunit, putative [Ricinus com... 61 2e-07 gb|EMS57313.1| Calcineurin subunit B [Triticum urartu] 60 2e-07 gb|EMS48596.1| Calcineurin subunit B [Triticum urartu] 60 2e-07 ref|XP_002276287.1| PREDICTED: calcineurin subunit B isoform 1 [... 60 2e-07 ref|XP_006341398.1| PREDICTED: calcineurin subunit B-like [Solan... 60 3e-07 ref|NP_001235920.1| uncharacterized protein LOC100305475 [Glycin... 60 3e-07 ref|XP_006385284.1| calcium-binding EF hand family protein [Popu... 60 3e-07 gb|ABK96332.1| unknown [Populus trichocarpa x Populus deltoides] 60 3e-07 ref|XP_006474041.1| PREDICTED: calcineurin subunit B-like isofor... 60 4e-07 ref|XP_006474040.1| PREDICTED: calcineurin subunit B-like isofor... 60 4e-07 ref|XP_006474039.1| PREDICTED: calcineurin subunit B-like isofor... 60 4e-07 ref|XP_004135865.1| PREDICTED: calcineurin subunit B-like [Cucum... 60 4e-07 gb|AAL25647.1|AF197330_1 calcineurin-like protein [Eucalyptus gr... 60 4e-07 ref|XP_007217704.1| hypothetical protein PRUPE_ppa012291mg [Prun... 59 5e-07 >ref|XP_007013873.1| Calcium-binding EF-hand family protein [Theobroma cacao] gi|508784236|gb|EOY31492.1| Calcium-binding EF-hand family protein [Theobroma cacao] Length = 175 Score = 65.5 bits (158), Expect = 8e-09 Identities = 31/41 (75%), Positives = 37/41 (90%) Frame = +1 Query: 1 QVLSHVLEEAGYTRESTLVLDDFIQILGNPGLKMEVEVHVD 123 QVL+HVLEEAGYT+ES LV+ DF++ILG+ GLKMEVEV VD Sbjct: 135 QVLTHVLEEAGYTKESLLVMSDFVKILGSSGLKMEVEVPVD 175 >gb|EMT09921.1| Calcineurin subunit B [Aegilops tauschii] Length = 134 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/41 (73%), Positives = 37/41 (90%) Frame = +1 Query: 1 QVLSHVLEEAGYTRESTLVLDDFIQILGNPGLKMEVEVHVD 123 QVL+ VLEEAGYTR+STL L+DF+ I+G+PGLKMEVEV +D Sbjct: 94 QVLTKVLEEAGYTRDSTLSLEDFVTIIGHPGLKMEVEVPID 134 >ref|XP_002271539.1| PREDICTED: calcineurin subunit B isoform 1 [Vitis vinifera] gi|297743542|emb|CBI36409.3| unnamed protein product [Vitis vinifera] Length = 175 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/41 (65%), Positives = 37/41 (90%) Frame = +1 Query: 1 QVLSHVLEEAGYTRESTLVLDDFIQILGNPGLKMEVEVHVD 123 QVLSHVL+EAGYTRES+ +L+DFI++LG+ +KM+VE+ VD Sbjct: 135 QVLSHVLQEAGYTRESSFLLEDFIKVLGSSSIKMDVEIPVD 175 >ref|XP_007154864.1| hypothetical protein PHAVU_003G154200g [Phaseolus vulgaris] gi|561028218|gb|ESW26858.1| hypothetical protein PHAVU_003G154200g [Phaseolus vulgaris] Length = 198 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/41 (68%), Positives = 36/41 (87%) Frame = +1 Query: 1 QVLSHVLEEAGYTRESTLVLDDFIQILGNPGLKMEVEVHVD 123 +VL+ VLEEAGY ++S+LVL DF++ILGN GLKMEVE+ VD Sbjct: 158 EVLTQVLEEAGYAKDSSLVLSDFVKILGNSGLKMEVEIPVD 198 >ref|XP_006453571.1| hypothetical protein CICLE_v10009711mg [Citrus clementina] gi|557556797|gb|ESR66811.1| hypothetical protein CICLE_v10009711mg [Citrus clementina] Length = 169 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/41 (68%), Positives = 36/41 (87%) Frame = +1 Query: 1 QVLSHVLEEAGYTRESTLVLDDFIQILGNPGLKMEVEVHVD 123 QVL+ VL+EAGYT++S ++L DF++ILGN GLKMEVEV VD Sbjct: 129 QVLTDVLDEAGYTKDSLMILSDFVKILGNSGLKMEVEVPVD 169 >gb|EMT15744.1| Calcineurin subunit B [Aegilops tauschii] Length = 157 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/41 (68%), Positives = 36/41 (87%) Frame = +1 Query: 1 QVLSHVLEEAGYTRESTLVLDDFIQILGNPGLKMEVEVHVD 123 QVL+ VLEEAGYT++STL L+DF+ I+ +PGLKMEVEV +D Sbjct: 117 QVLTKVLEEAGYTQDSTLALEDFVTIIDHPGLKMEVEVPID 157 >ref|XP_002517685.1| calcineurin B subunit, putative [Ricinus communis] gi|223543317|gb|EEF44849.1| calcineurin B subunit, putative [Ricinus communis] Length = 175 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = +1 Query: 1 QVLSHVLEEAGYTRESTLVLDDFIQILGNPGLKMEVEVHVD 123 QVL VL+EAGYTRES L+LDDFI++ GN GL MEVEV VD Sbjct: 135 QVLCQVLKEAGYTRESYLMLDDFIKVFGNSGLTMEVEVPVD 175 >gb|EMS57313.1| Calcineurin subunit B [Triticum urartu] Length = 175 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/41 (68%), Positives = 36/41 (87%) Frame = +1 Query: 1 QVLSHVLEEAGYTRESTLVLDDFIQILGNPGLKMEVEVHVD 123 QVL+ VLEEAGYT++STL L+DF+ I+ +PGLKMEVEV +D Sbjct: 135 QVLTKVLEEAGYTQDSTLSLEDFVTIIDHPGLKMEVEVPID 175 >gb|EMS48596.1| Calcineurin subunit B [Triticum urartu] Length = 175 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/41 (68%), Positives = 36/41 (87%) Frame = +1 Query: 1 QVLSHVLEEAGYTRESTLVLDDFIQILGNPGLKMEVEVHVD 123 QVL+ VLEEAGYT++STL L+DF+ I+ +PGLKMEVEV +D Sbjct: 135 QVLTKVLEEAGYTQDSTLSLEDFVTIIDHPGLKMEVEVPID 175 >ref|XP_002276287.1| PREDICTED: calcineurin subunit B isoform 1 [Vitis vinifera] gi|147822751|emb|CAN72695.1| hypothetical protein VITISV_007127 [Vitis vinifera] gi|297743673|emb|CBI36556.3| unnamed protein product [Vitis vinifera] Length = 175 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = +1 Query: 1 QVLSHVLEEAGYTRESTLVLDDFIQILGNPGLKMEVEVHVD 123 +VL+ VLEEAGY + S LVL DF++ILGNP LKMEVEV VD Sbjct: 135 EVLTQVLEEAGYNKNSLLVLSDFVKILGNPDLKMEVEVPVD 175 >ref|XP_006341398.1| PREDICTED: calcineurin subunit B-like [Solanum tuberosum] Length = 175 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/41 (68%), Positives = 36/41 (87%) Frame = +1 Query: 1 QVLSHVLEEAGYTRESTLVLDDFIQILGNPGLKMEVEVHVD 123 +VLS VL EAGYTR+S L+L+DFI+I+ +PGLKMEVEV +D Sbjct: 135 EVLSQVLHEAGYTRDSLLLLNDFIKIMDHPGLKMEVEVPID 175 >ref|NP_001235920.1| uncharacterized protein LOC100305475 [Glycine max] gi|255625619|gb|ACU13154.1| unknown [Glycine max] Length = 175 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = +1 Query: 4 VLSHVLEEAGYTRESTLVLDDFIQILGNPGLKMEVEVHVD 123 VL+ VLEEAGY ++S+LVL DF++ILGN GLKMEVEV VD Sbjct: 136 VLTQVLEEAGYAKDSSLVLSDFMKILGNSGLKMEVEVPVD 175 >ref|XP_006385284.1| calcium-binding EF hand family protein [Populus trichocarpa] gi|566160469|ref|XP_006385285.1| hypothetical protein POPTR_0003s02440g [Populus trichocarpa] gi|550342224|gb|ERP63081.1| calcium-binding EF hand family protein [Populus trichocarpa] gi|550342225|gb|ERP63082.1| hypothetical protein POPTR_0003s02440g [Populus trichocarpa] Length = 175 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = +1 Query: 1 QVLSHVLEEAGYTRESTLVLDDFIQILGNPGLKMEVEVHVD 123 +VL VL+EAGYTRES L+LDDFI++ GN GLK+EVEV VD Sbjct: 135 KVLIQVLKEAGYTRESYLMLDDFIKVFGNSGLKLEVEVPVD 175 >gb|ABK96332.1| unknown [Populus trichocarpa x Populus deltoides] Length = 116 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = +1 Query: 1 QVLSHVLEEAGYTRESTLVLDDFIQILGNPGLKMEVEVHVD 123 +VL VL+EAGYTRES L+LDDFI++ GN GLK+EVEV VD Sbjct: 76 KVLIQVLKEAGYTRESYLMLDDFIKVFGNSGLKLEVEVPVD 116 >ref|XP_006474041.1| PREDICTED: calcineurin subunit B-like isoform X3 [Citrus sinensis] Length = 169 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/41 (65%), Positives = 36/41 (87%) Frame = +1 Query: 1 QVLSHVLEEAGYTRESTLVLDDFIQILGNPGLKMEVEVHVD 123 QVL+ VL+EAGYT++S ++L DF++ILGN GLK+EVEV VD Sbjct: 129 QVLTDVLDEAGYTKDSLMILSDFVKILGNSGLKIEVEVPVD 169 >ref|XP_006474040.1| PREDICTED: calcineurin subunit B-like isoform X2 [Citrus sinensis] Length = 171 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/41 (65%), Positives = 36/41 (87%) Frame = +1 Query: 1 QVLSHVLEEAGYTRESTLVLDDFIQILGNPGLKMEVEVHVD 123 QVL+ VL+EAGYT++S ++L DF++ILGN GLK+EVEV VD Sbjct: 131 QVLTDVLDEAGYTKDSLMILSDFVKILGNSGLKIEVEVPVD 171 >ref|XP_006474039.1| PREDICTED: calcineurin subunit B-like isoform X1 [Citrus sinensis] Length = 175 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/41 (65%), Positives = 36/41 (87%) Frame = +1 Query: 1 QVLSHVLEEAGYTRESTLVLDDFIQILGNPGLKMEVEVHVD 123 QVL+ VL+EAGYT++S ++L DF++ILGN GLK+EVEV VD Sbjct: 135 QVLTDVLDEAGYTKDSLMILSDFVKILGNSGLKIEVEVPVD 175 >ref|XP_004135865.1| PREDICTED: calcineurin subunit B-like [Cucumis sativus] gi|449509301|ref|XP_004163549.1| PREDICTED: calcineurin subunit B-like [Cucumis sativus] Length = 175 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = +1 Query: 1 QVLSHVLEEAGYTRESTLVLDDFIQILGNPGLKMEVEVHVD 123 QVL +L+EAGYTR S L LDDF+++LGN G+KM+VEV VD Sbjct: 135 QVLCQLLQEAGYTRNSQLTLDDFVKVLGNSGIKMDVEVPVD 175 >gb|AAL25647.1|AF197330_1 calcineurin-like protein [Eucalyptus grandis] gi|16550937|gb|AAL25650.1|AF197334_1 calcineurin-like protein [Eucalyptus camaldulensis] Length = 175 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = +1 Query: 1 QVLSHVLEEAGYTRESTLVLDDFIQILGNPGLKMEVEVHVD 123 QVL VL+EAGYTRES L+LDDF+++ GN LKMEVEV VD Sbjct: 135 QVLVQVLKEAGYTRESYLLLDDFVKVFGNSDLKMEVEVPVD 175 >ref|XP_007217704.1| hypothetical protein PRUPE_ppa012291mg [Prunus persica] gi|595973301|ref|XP_007217705.1| hypothetical protein PRUPE_ppa012291mg [Prunus persica] gi|462413854|gb|EMJ18903.1| hypothetical protein PRUPE_ppa012291mg [Prunus persica] gi|462413855|gb|EMJ18904.1| hypothetical protein PRUPE_ppa012291mg [Prunus persica] Length = 175 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/41 (65%), Positives = 36/41 (87%) Frame = +1 Query: 1 QVLSHVLEEAGYTRESTLVLDDFIQILGNPGLKMEVEVHVD 123 +VL+ VL+EAGYTRES L LDDF+++LG+ G+KMEVEV +D Sbjct: 135 KVLTQVLQEAGYTRESYLTLDDFVKVLGSYGVKMEVEVPID 175