BLASTX nr result
ID: Akebia23_contig00063309
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00063309 (309 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EON62005.1| hypothetical protein W97_01224 [Coniosporium apol... 83 3e-14 gb|EON97292.1| putative glycine-rich rna-binding protein [Tognin... 77 2e-12 gb|EJT81866.1| hypothetical protein GGTG_01840 [Gaeumannomyces g... 77 2e-12 ref|XP_007585325.1| putative rna recognition domain-containing p... 77 2e-12 gb|ELR10329.1| hypothetical protein GMDG_04711 [Pseudogymnoascus... 77 2e-12 gb|ELQ42715.1| hypothetical protein OOU_Y34scaffold00194g28 [Mag... 77 2e-12 gb|EKG22234.1| hypothetical protein MPH_00413 [Macrophomina phas... 77 2e-12 ref|XP_003713746.1| hypothetical protein MGG_04816 [Magnaporthe ... 77 2e-12 gb|EPE27204.1| RNA-binding, RBD [Glarea lozoyensis ATCC 20868] 76 4e-12 gb|EME38231.1| hypothetical protein DOTSEDRAFT_140462 [Dothistro... 76 4e-12 gb|EHL00628.1| putative Cold-inducible RNA-binding protein [Glar... 76 4e-12 ref|XP_007290407.1| glycine-rich RNA-binding protein [Marssonina... 76 6e-12 gb|EGX50762.1| hypothetical protein AOL_s00054g848 [Arthrobotrys... 76 6e-12 ref|XP_003852648.1| hypothetical protein MYCGRDRAFT_104484 [Zymo... 76 6e-12 ref|XP_002846246.1| glycine-rich RNA-binding protein [Arthroderm... 75 7e-12 gb|EMC95324.1| hypothetical protein BAUCODRAFT_123780 [Baudoinia... 75 1e-11 ref|XP_754757.1| glycine-rich RNA-binding protein [Aspergillus f... 74 2e-11 gb|EMF10887.1| RNA-binding domain-containing protein [Sphaerulin... 74 2e-11 gb|EFW99582.1| glycine-rich RNA-binding protein [Grosmannia clav... 74 2e-11 ref|XP_001263582.1| glycine-rich RNA-binding protein, putative [... 74 2e-11 >gb|EON62005.1| hypothetical protein W97_01224 [Coniosporium apollinis CBS 100218] Length = 172 Score = 83.2 bits (204), Expect = 3e-14 Identities = 39/46 (84%), Positives = 42/46 (91%) Frame = +2 Query: 2 KDRDTGRSRGFGFVSFSNEDEADAAIKGMNEIEFDGRTIRVDKASE 139 KDRDTGRSRGFGFV FSN+ EADAAI+ MN +EFDGRTIRVDKASE Sbjct: 35 KDRDTGRSRGFGFVRFSNDSEADAAIQSMNNVEFDGRTIRVDKASE 80 >gb|EON97292.1| putative glycine-rich rna-binding protein [Togninia minima UCRPA7] Length = 186 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = +2 Query: 2 KDRDTGRSRGFGFVSFSNEDEADAAIKGMNEIEFDGRTIRVDKASE 139 KDRDTGRSRGFGFV ++NED+A AI MN +EFDGRTIRVDKAS+ Sbjct: 35 KDRDTGRSRGFGFVRYTNEDDAQKAISAMNNVEFDGRTIRVDKASD 80 >gb|EJT81866.1| hypothetical protein GGTG_01840 [Gaeumannomyces graminis var. tritici R3-111a-1] Length = 192 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = +2 Query: 2 KDRDTGRSRGFGFVSFSNEDEADAAIKGMNEIEFDGRTIRVDKASE 139 KDRDTGRSRGFGFV ++NED+A AI MN +EFDGRTIRVDKAS+ Sbjct: 35 KDRDTGRSRGFGFVRYTNEDDAQRAISAMNNVEFDGRTIRVDKASD 80 >ref|XP_007585325.1| putative rna recognition domain-containing protein [Neofusicoccum parvum UCRNP2] gi|485921491|gb|EOD47197.1| putative rna recognition domain-containing protein [Neofusicoccum parvum UCRNP2] Length = 152 Score = 77.0 bits (188), Expect = 2e-12 Identities = 35/46 (76%), Positives = 41/46 (89%) Frame = +2 Query: 2 KDRDTGRSRGFGFVSFSNEDEADAAIKGMNEIEFDGRTIRVDKASE 139 KDRDTGRSRGFGFV F+ E +A+AAI+ MN +EFDGRTIRVDKAS+ Sbjct: 35 KDRDTGRSRGFGFVRFTQESDAEAAIQSMNNVEFDGRTIRVDKASD 80 >gb|ELR10329.1| hypothetical protein GMDG_04711 [Pseudogymnoascus destructans 20631-21] Length = 173 Score = 77.0 bits (188), Expect = 2e-12 Identities = 37/46 (80%), Positives = 39/46 (84%) Frame = +2 Query: 2 KDRDTGRSRGFGFVSFSNEDEADAAIKGMNEIEFDGRTIRVDKASE 139 KDRDTGRSRGFGFV + E +ADAAI MN IEFDGRTIRVDKASE Sbjct: 35 KDRDTGRSRGFGFVRYGQEADADAAIAAMNNIEFDGRTIRVDKASE 80 >gb|ELQ42715.1| hypothetical protein OOU_Y34scaffold00194g28 [Magnaporthe oryzae Y34] gi|440489138|gb|ELQ68816.1| hypothetical protein OOW_P131scaffold00217g29 [Magnaporthe oryzae P131] Length = 182 Score = 77.0 bits (188), Expect = 2e-12 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = +2 Query: 2 KDRDTGRSRGFGFVSFSNEDEADAAIKGMNEIEFDGRTIRVDKASE 139 KDRDTGRSRGFGFV ++NED+A AI MN +EFDGRTIRVDKAS+ Sbjct: 36 KDRDTGRSRGFGFVRYTNEDDAQKAITAMNNVEFDGRTIRVDKASD 81 >gb|EKG22234.1| hypothetical protein MPH_00413 [Macrophomina phaseolina MS6] Length = 159 Score = 77.0 bits (188), Expect = 2e-12 Identities = 35/46 (76%), Positives = 41/46 (89%) Frame = +2 Query: 2 KDRDTGRSRGFGFVSFSNEDEADAAIKGMNEIEFDGRTIRVDKASE 139 KDRDTGRSRGFGFV F+ E +A+AAI+ MN +EFDGRTIRVDKAS+ Sbjct: 35 KDRDTGRSRGFGFVRFTQESDAEAAIQAMNNVEFDGRTIRVDKASD 80 >ref|XP_003713746.1| hypothetical protein MGG_04816 [Magnaporthe oryzae 70-15] gi|351646079|gb|EHA53939.1| hypothetical protein MGG_04816 [Magnaporthe oryzae 70-15] Length = 236 Score = 77.0 bits (188), Expect = 2e-12 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = +2 Query: 2 KDRDTGRSRGFGFVSFSNEDEADAAIKGMNEIEFDGRTIRVDKASE 139 KDRDTGRSRGFGFV ++NED+A AI MN +EFDGRTIRVDKAS+ Sbjct: 90 KDRDTGRSRGFGFVRYTNEDDAQKAITAMNNVEFDGRTIRVDKASD 135 >gb|EPE27204.1| RNA-binding, RBD [Glarea lozoyensis ATCC 20868] Length = 168 Score = 76.3 bits (186), Expect = 4e-12 Identities = 36/46 (78%), Positives = 39/46 (84%) Frame = +2 Query: 2 KDRDTGRSRGFGFVSFSNEDEADAAIKGMNEIEFDGRTIRVDKASE 139 KDRDTGRSRGFGFV + E +A+AAI MN IEFDGRTIRVDKASE Sbjct: 35 KDRDTGRSRGFGFVRYGQESDAEAAITAMNNIEFDGRTIRVDKASE 80 >gb|EME38231.1| hypothetical protein DOTSEDRAFT_140462 [Dothistroma septosporum NZE10] Length = 170 Score = 76.3 bits (186), Expect = 4e-12 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = +2 Query: 2 KDRDTGRSRGFGFVSFSNEDEADAAIKGMNEIEFDGRTIRVDKASE 139 KDRDTGRSRGFGFV F+ + ADAAI+ MN +EFDGRTIRVDKAS+ Sbjct: 32 KDRDTGRSRGFGFVRFAEDSAADAAIQAMNNVEFDGRTIRVDKASD 77 >gb|EHL00628.1| putative Cold-inducible RNA-binding protein [Glarea lozoyensis 74030] Length = 170 Score = 76.3 bits (186), Expect = 4e-12 Identities = 36/46 (78%), Positives = 39/46 (84%) Frame = +2 Query: 2 KDRDTGRSRGFGFVSFSNEDEADAAIKGMNEIEFDGRTIRVDKASE 139 KDRDTGRSRGFGFV + E +A+AAI MN IEFDGRTIRVDKASE Sbjct: 35 KDRDTGRSRGFGFVRYGQESDAEAAITAMNNIEFDGRTIRVDKASE 80 >ref|XP_007290407.1| glycine-rich RNA-binding protein [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406866241|gb|EKD19281.1| glycine-rich RNA-binding protein [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 423 Score = 75.9 bits (185), Expect = 6e-12 Identities = 36/46 (78%), Positives = 40/46 (86%) Frame = +2 Query: 2 KDRDTGRSRGFGFVSFSNEDEADAAIKGMNEIEFDGRTIRVDKASE 139 KDRDTGRSRGFGFV + +E +A+AAI MN IEFDGRTIRVDKASE Sbjct: 193 KDRDTGRSRGFGFVRYGSEADAEAAITAMNNIEFDGRTIRVDKASE 238 >gb|EGX50762.1| hypothetical protein AOL_s00054g848 [Arthrobotrys oligospora ATCC 24927] Length = 130 Score = 75.9 bits (185), Expect = 6e-12 Identities = 36/46 (78%), Positives = 40/46 (86%) Frame = +2 Query: 2 KDRDTGRSRGFGFVSFSNEDEADAAIKGMNEIEFDGRTIRVDKASE 139 KDRDTGRSRGFGFV FSN+DEA AA + MN+ EFDGR IRVDKAS+ Sbjct: 35 KDRDTGRSRGFGFVRFSNDDEATAAQEAMNDAEFDGRRIRVDKASD 80 >ref|XP_003852648.1| hypothetical protein MYCGRDRAFT_104484 [Zymoseptoria tritici IPO323] gi|339472529|gb|EGP87624.1| hypothetical protein MYCGRDRAFT_104484 [Zymoseptoria tritici IPO323] Length = 184 Score = 75.9 bits (185), Expect = 6e-12 Identities = 36/46 (78%), Positives = 40/46 (86%) Frame = +2 Query: 2 KDRDTGRSRGFGFVSFSNEDEADAAIKGMNEIEFDGRTIRVDKASE 139 KDRDTGRSRGFGFV F+++ ADAAI MN +EFDGRTIRVDKASE Sbjct: 35 KDRDTGRSRGFGFVRFADDAGADAAITAMNNVEFDGRTIRVDKASE 80 >ref|XP_002846246.1| glycine-rich RNA-binding protein [Arthroderma otae CBS 113480] gi|238843634|gb|EEQ33296.1| glycine-rich RNA-binding protein [Arthroderma otae CBS 113480] Length = 133 Score = 75.5 bits (184), Expect = 7e-12 Identities = 36/46 (78%), Positives = 38/46 (82%) Frame = +2 Query: 2 KDRDTGRSRGFGFVSFSNEDEADAAIKGMNEIEFDGRTIRVDKASE 139 KDRDT RSRGFGFV FSNE EADAA+ MN EFDGR IRVDKA+E Sbjct: 37 KDRDTNRSRGFGFVRFSNESEADAALNAMNNQEFDGRVIRVDKATE 82 >gb|EMC95324.1| hypothetical protein BAUCODRAFT_123780 [Baudoinia compniacensis UAMH 10762] Length = 169 Score = 74.7 bits (182), Expect = 1e-11 Identities = 35/46 (76%), Positives = 39/46 (84%) Frame = +2 Query: 2 KDRDTGRSRGFGFVSFSNEDEADAAIKGMNEIEFDGRTIRVDKASE 139 KDRDTGRSRGFGFV F+ + AD+AI MN +EFDGRTIRVDKASE Sbjct: 36 KDRDTGRSRGFGFVRFAEDAAADSAIAAMNNVEFDGRTIRVDKASE 81 >ref|XP_754757.1| glycine-rich RNA-binding protein [Aspergillus fumigatus Af293] gi|66852394|gb|EAL92719.1| glycine-rich RNA-binding protein, putative [Aspergillus fumigatus Af293] gi|159127765|gb|EDP52880.1| glycine-rich RNA-binding protein, putative [Aspergillus fumigatus A1163] Length = 118 Score = 74.3 bits (181), Expect = 2e-11 Identities = 36/46 (78%), Positives = 39/46 (84%) Frame = +2 Query: 2 KDRDTGRSRGFGFVSFSNEDEADAAIKGMNEIEFDGRTIRVDKASE 139 KDRDT RSRGFGFV FS++ EADAA+ MN EFDGRTIRVDKASE Sbjct: 35 KDRDTNRSRGFGFVRFSSDTEADAAMDAMNNQEFDGRTIRVDKASE 80 >gb|EMF10887.1| RNA-binding domain-containing protein [Sphaerulina musiva SO2202] Length = 178 Score = 74.3 bits (181), Expect = 2e-11 Identities = 35/46 (76%), Positives = 39/46 (84%) Frame = +2 Query: 2 KDRDTGRSRGFGFVSFSNEDEADAAIKGMNEIEFDGRTIRVDKASE 139 KDRDTGRSRGFGFV F+ + ADAAI MN +EFDGRTIRVDKAS+ Sbjct: 35 KDRDTGRSRGFGFVRFAEDAGADAAIAAMNNVEFDGRTIRVDKASD 80 >gb|EFW99582.1| glycine-rich RNA-binding protein [Grosmannia clavigera kw1407] Length = 462 Score = 74.3 bits (181), Expect = 2e-11 Identities = 34/46 (73%), Positives = 40/46 (86%) Frame = +2 Query: 2 KDRDTGRSRGFGFVSFSNEDEADAAIKGMNEIEFDGRTIRVDKASE 139 KDRDTGRSRGFGFV ++NE +A+ AI MN IEFDGRTIRVD+AS+ Sbjct: 316 KDRDTGRSRGFGFVRYANEADAETAIASMNNIEFDGRTIRVDRASD 361 >ref|XP_001263582.1| glycine-rich RNA-binding protein, putative [Neosartorya fischeri NRRL 181] gi|119411742|gb|EAW21685.1| glycine-rich RNA-binding protein, putative [Neosartorya fischeri NRRL 181] Length = 118 Score = 74.3 bits (181), Expect = 2e-11 Identities = 36/46 (78%), Positives = 39/46 (84%) Frame = +2 Query: 2 KDRDTGRSRGFGFVSFSNEDEADAAIKGMNEIEFDGRTIRVDKASE 139 KDRDT RSRGFGFV FS++ EADAA+ MN EFDGRTIRVDKASE Sbjct: 35 KDRDTNRSRGFGFVRFSSDTEADAAMDAMNNQEFDGRTIRVDKASE 80