BLASTX nr result
ID: Akebia23_contig00062876
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00062876 (345 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006858375.1| hypothetical protein AMTR_s00064p00202170 [A... 62 6e-08 ref|XP_002309223.1| hypothetical protein POPTR_0006s15520g [Popu... 60 3e-07 ref|XP_007052341.1| Atypical CYS HIS rich thioredoxin 2 [Theobro... 60 4e-07 ref|XP_004513104.1| PREDICTED: thioredoxin-like 2, chloroplastic... 60 4e-07 ref|XP_002514101.1| Thioredoxin, putative [Ricinus communis] gi|... 60 4e-07 ref|XP_004287548.1| PREDICTED: thioredoxin-like 2, chloroplastic... 59 5e-07 ref|XP_007202539.1| hypothetical protein PRUPE_ppa011072mg [Prun... 59 5e-07 ref|XP_003517423.1| PREDICTED: thioredoxin-like 2, chloroplastic... 59 7e-07 gb|ACU19208.1| unknown [Glycine max] 59 7e-07 ref|XP_002282326.1| PREDICTED: thioredoxin-like 2, chloroplastic... 59 7e-07 ref|XP_003620940.1| Thioredoxin-like protein [Medicago truncatul... 59 7e-07 emb|CAN62376.1| hypothetical protein VITISV_000883 [Vitis vinifera] 59 7e-07 ref|XP_006451447.1| hypothetical protein CICLE_v10009373mg [Citr... 59 9e-07 ref|XP_007012859.1| Atypical CYS HIS rich thioredoxin 2, putativ... 59 9e-07 ref|XP_007012858.1| Atypical CYS HIS rich thioredoxin 2, putativ... 59 9e-07 ref|XP_004133814.1| PREDICTED: thioredoxin-like 2, chloroplastic... 59 9e-07 ref|XP_003529085.1| PREDICTED: thioredoxin-like 2, chloroplastic... 58 2e-06 gb|ACU18560.1| unknown [Glycine max] 58 2e-06 ref|NP_849469.1| thioredoxin-like 2-2 [Arabidopsis thaliana] gi|... 57 2e-06 ref|XP_006284462.1| hypothetical protein CARUB_v10005641mg [Caps... 57 2e-06 >ref|XP_006858375.1| hypothetical protein AMTR_s00064p00202170 [Amborella trichopoda] gi|548862482|gb|ERN19842.1| hypothetical protein AMTR_s00064p00202170 [Amborella trichopoda] Length = 227 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +1 Query: 211 QLCKTAEGHPDILILKVDFDENKPMCKCLNVKV 309 +LCKTAE HPDIL LKV+FDENKPMCK LNVKV Sbjct: 126 KLCKTAEEHPDILFLKVNFDENKPMCKSLNVKV 158 >ref|XP_002309223.1| hypothetical protein POPTR_0006s15520g [Populus trichocarpa] gi|222855199|gb|EEE92746.1| hypothetical protein POPTR_0006s15520g [Populus trichocarpa] Length = 220 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +1 Query: 211 QLCKTAEGHPDILILKVDFDENKPMCKCLNVKV 309 +LC+TAE HP+IL LKV+FDENKPMCK LNVKV Sbjct: 122 KLCRTAEDHPEILFLKVNFDENKPMCKSLNVKV 154 >ref|XP_007052341.1| Atypical CYS HIS rich thioredoxin 2 [Theobroma cacao] gi|508704602|gb|EOX96498.1| Atypical CYS HIS rich thioredoxin 2 [Theobroma cacao] Length = 234 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +1 Query: 211 QLCKTAEGHPDILILKVDFDENKPMCKCLNVKV 309 +LCKTAE HP+I+ LKV+FDENKPMCK LNVKV Sbjct: 136 KLCKTAEEHPEIVFLKVNFDENKPMCKSLNVKV 168 >ref|XP_004513104.1| PREDICTED: thioredoxin-like 2, chloroplastic-like [Cicer arietinum] Length = 216 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +1 Query: 211 QLCKTAEGHPDILILKVDFDENKPMCKCLNVKV 309 +LC+TAE HP+IL LKV+FDENKPMCK LNVKV Sbjct: 118 KLCRTAEEHPEILFLKVNFDENKPMCKSLNVKV 150 >ref|XP_002514101.1| Thioredoxin, putative [Ricinus communis] gi|223546557|gb|EEF48055.1| Thioredoxin, putative [Ricinus communis] Length = 227 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +1 Query: 211 QLCKTAEGHPDILILKVDFDENKPMCKCLNVKV 309 +LC+TAE HP+IL LKV+FDENKPMCK LNVKV Sbjct: 129 KLCRTAEEHPEILFLKVNFDENKPMCKSLNVKV 161 >ref|XP_004287548.1| PREDICTED: thioredoxin-like 2, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 222 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = +1 Query: 211 QLCKTAEGHPDILILKVDFDENKPMCKCLNVKV 309 +LC+TAE HP+IL LKV+FDENKPMCK +NVKV Sbjct: 122 KLCRTAEDHPEILFLKVNFDENKPMCKSMNVKV 154 >ref|XP_007202539.1| hypothetical protein PRUPE_ppa011072mg [Prunus persica] gi|462398070|gb|EMJ03738.1| hypothetical protein PRUPE_ppa011072mg [Prunus persica] Length = 225 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = +1 Query: 211 QLCKTAEGHPDILILKVDFDENKPMCKCLNVKV 309 +LC+TAE HP+IL LKV+FDENKPMCK +NVKV Sbjct: 125 KLCRTAEDHPEILFLKVNFDENKPMCKSMNVKV 157 >ref|XP_003517423.1| PREDICTED: thioredoxin-like 2, chloroplastic-like [Glycine max] Length = 212 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +1 Query: 211 QLCKTAEGHPDILILKVDFDENKPMCKCLNVKV 309 +LC+TAE HP+IL LKV+FDENKPMCK LNVKV Sbjct: 114 KLCRTAEEHPEILFLKVNFDENKPMCKRLNVKV 146 >gb|ACU19208.1| unknown [Glycine max] Length = 212 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +1 Query: 211 QLCKTAEGHPDILILKVDFDENKPMCKCLNVKV 309 +LC+TAE HP+IL LKV+FDENKPMCK LNVKV Sbjct: 114 KLCRTAEEHPEILFLKVNFDENKPMCKRLNVKV 146 >ref|XP_002282326.1| PREDICTED: thioredoxin-like 2, chloroplastic [Vitis vinifera] gi|297738677|emb|CBI27922.3| unnamed protein product [Vitis vinifera] Length = 207 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +1 Query: 211 QLCKTAEGHPDILILKVDFDENKPMCKCLNVKV 309 +LC+TAE HP+IL LKV+FDENKPMCK LNVKV Sbjct: 120 KLCRTAEEHPEILFLKVNFDENKPMCKNLNVKV 152 >ref|XP_003620940.1| Thioredoxin-like protein [Medicago truncatula] gi|355495955|gb|AES77158.1| Thioredoxin-like protein [Medicago truncatula] Length = 214 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = +1 Query: 211 QLCKTAEGHPDILILKVDFDENKPMCKCLNVKV 309 +LC+TAE HP+I+ LKV+FDENKPMCK LNVKV Sbjct: 116 KLCRTAEEHPEIIFLKVNFDENKPMCKSLNVKV 148 >emb|CAN62376.1| hypothetical protein VITISV_000883 [Vitis vinifera] Length = 149 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +1 Query: 211 QLCKTAEGHPDILILKVDFDENKPMCKCLNVKV 309 +LC+TAE HP+IL LKV+FDENKPMCK LNVKV Sbjct: 62 KLCRTAEEHPEILFLKVNFDENKPMCKNLNVKV 94 >ref|XP_006451447.1| hypothetical protein CICLE_v10009373mg [Citrus clementina] gi|568843067|ref|XP_006475443.1| PREDICTED: thioredoxin-like 2, chloroplastic-like [Citrus sinensis] gi|557554673|gb|ESR64687.1| hypothetical protein CICLE_v10009373mg [Citrus clementina] Length = 231 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = +1 Query: 211 QLCKTAEGHPDILILKVDFDENKPMCKCLNVKV 309 +LC+TAE HP+I+ LKV+FDENKPMCK LNVKV Sbjct: 133 KLCRTAEEHPEIVFLKVNFDENKPMCKSLNVKV 165 >ref|XP_007012859.1| Atypical CYS HIS rich thioredoxin 2, putative isoform 2, partial [Theobroma cacao] gi|508783222|gb|EOY30478.1| Atypical CYS HIS rich thioredoxin 2, putative isoform 2, partial [Theobroma cacao] Length = 177 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = +1 Query: 211 QLCKTAEGHPDILILKVDFDENKPMCKCLNVKV 309 +LC+TA+ HP+IL LKV+FDENKPMCK LNVKV Sbjct: 133 KLCRTAQEHPEILFLKVNFDENKPMCKSLNVKV 165 >ref|XP_007012858.1| Atypical CYS HIS rich thioredoxin 2, putative isoform 1 [Theobroma cacao] gi|508783221|gb|EOY30477.1| Atypical CYS HIS rich thioredoxin 2, putative isoform 1 [Theobroma cacao] Length = 231 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = +1 Query: 211 QLCKTAEGHPDILILKVDFDENKPMCKCLNVKV 309 +LC+TA+ HP+IL LKV+FDENKPMCK LNVKV Sbjct: 133 KLCRTAQEHPEILFLKVNFDENKPMCKSLNVKV 165 >ref|XP_004133814.1| PREDICTED: thioredoxin-like 2, chloroplastic-like [Cucumis sativus] gi|449477927|ref|XP_004155164.1| PREDICTED: thioredoxin-like 2, chloroplastic-like [Cucumis sativus] Length = 224 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = +1 Query: 211 QLCKTAEGHPDILILKVDFDENKPMCKCLNVKV 309 +LC+TA+ HP+IL LKV+FDENKPMCK LNVKV Sbjct: 130 RLCRTADEHPEILFLKVNFDENKPMCKSLNVKV 162 >ref|XP_003529085.1| PREDICTED: thioredoxin-like 2, chloroplastic-like [Glycine max] Length = 219 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = +1 Query: 211 QLCKTAEGHPDILILKVDFDENKPMCKCLNVKV 309 +LC+TAE HP+I+ LKV+FDENKPMCK LNVKV Sbjct: 121 KLCRTAEEHPEIVFLKVNFDENKPMCKRLNVKV 153 >gb|ACU18560.1| unknown [Glycine max] Length = 219 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = +1 Query: 211 QLCKTAEGHPDILILKVDFDENKPMCKCLNVKV 309 +LC+TAE HP+I+ LKV+FDENKPMCK LNVKV Sbjct: 121 KLCRTAEEHPEIVFLKVNFDENKPMCKRLNVKV 153 >ref|NP_849469.1| thioredoxin-like 2-2 [Arabidopsis thaliana] gi|52000831|sp|Q8LCT3.2|TRL22_ARATH RecName: Full=Thioredoxin-like 2-2, chloroplastic; AltName: Full=Atypical cysteine/histidine-rich thioredoxin 2; Short=AtACHT2; Flags: Precursor gi|13877715|gb|AAK43935.1|AF370616_1 Thioredoxin-like protein [Arabidopsis thaliana] gi|5123561|emb|CAB45327.1| Thioredoxin-like protein [Arabidopsis thaliana] gi|7269866|emb|CAB79725.1| Thioredoxin-like protein [Arabidopsis thaliana] gi|332660260|gb|AEE85660.1| thioredoxin-like 2-2 [Arabidopsis thaliana] Length = 236 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +1 Query: 211 QLCKTAEGHPDILILKVDFDENKPMCKCLNVKV 309 +LCKTA HPDI+ LKV+FDENKPMCK LNV+V Sbjct: 144 KLCKTAVEHPDIVFLKVNFDENKPMCKSLNVRV 176 >ref|XP_006284462.1| hypothetical protein CARUB_v10005641mg [Capsella rubella] gi|482553167|gb|EOA17360.1| hypothetical protein CARUB_v10005641mg [Capsella rubella] Length = 235 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +1 Query: 211 QLCKTAEGHPDILILKVDFDENKPMCKCLNVKV 309 +LCKTA HPDI+ LKV+FDENKPMCK LNV+V Sbjct: 144 KLCKTAVEHPDIVFLKVNFDENKPMCKSLNVRV 176