BLASTX nr result
ID: Akebia23_contig00061797
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00061797 (300 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003851349.1| hypothetical protein MYCGRDRAFT_44262 [Zymos... 182 4e-44 ref|XP_007289177.1| thiazole biosynthetic enzyme [Marssonina bru... 181 9e-44 gb|EMD00030.1| hypothetical protein BAUCODRAFT_62660 [Baudoinia ... 181 1e-43 ref|XP_006666857.1| thiazole biosynthetic enzyme [Cordyceps mili... 180 2e-43 gb|EFY99491.1| thiazole biosynthetic enzyme variant 1 [Metarhizi... 179 3e-43 gb|ACN39013.1| thiazole synthase [Epichloe festucae] 179 3e-43 gb|ABN45974.1| thiazole biosynthetic enzyme variant 1 [Neotyphod... 179 3e-43 gb|ABN45968.1| thiazole biosynthetic enzyme variant 1 [Epichloe ... 179 3e-43 gb|EMF12655.1| thiazole biosynthetic enzyme, mitochondrial [Spha... 179 4e-43 gb|EXK40264.1| thiamine biosynthetic enzyme [Fusarium oxysporum ... 178 6e-43 gb|EWG49587.1| thiamine biosynthetic enzyme [Fusarium verticilli... 178 6e-43 gb|EWG49586.1| thiamine biosynthetic enzyme [Fusarium verticilli... 178 6e-43 sp|P23618.2|THI4_FUSOX RecName: Full=Thiamine thiazole synthase;... 178 6e-43 gb|EPE26179.1| FAD/NAD(P)-binding protein [Glarea lozoyensis ATC... 178 6e-43 ref|XP_007586590.1| putative thiazole biosynthetic enzyme protei... 178 6e-43 gb|EMT70803.1| Thiazole biosynthetic enzyme, mitochondrial [Fusa... 178 6e-43 gb|EME42084.1| hypothetical protein DOTSEDRAFT_73000 [Dothistrom... 178 6e-43 gb|EKJ77843.1| hypothetical protein FPSE_01936 [Fusarium pseudog... 178 6e-43 gb|EHL02685.1| putative Thiazole biosynthetic enzyme, mitochondr... 178 6e-43 ref|XP_001549602.1| thiazole biosynthetic enzyme [Botryotinia fu... 178 6e-43 >ref|XP_003851349.1| hypothetical protein MYCGRDRAFT_44262 [Zymoseptoria tritici IPO323] gi|339471229|gb|EGP86325.1| hypothetical protein MYCGRDRAFT_44262 [Zymoseptoria tritici IPO323] Length = 318 Score = 182 bits (462), Expect = 4e-44 Identities = 88/99 (88%), Positives = 96/99 (96%) Frame = +1 Query: 1 FKFSAIRESQVSRAMTRRYFTDLDTYAESDIVIVGAGSCGLSSAYMLGKARPDLKIAIVE 180 FKF+ IRESQVSRAMTRRYF+DLDTYAESDIVIVGAGSCGLS+AY L KARPDLKIAI+E Sbjct: 38 FKFAPIRESQVSRAMTRRYFSDLDTYAESDIVIVGAGSCGLSAAYCLAKARPDLKIAIIE 97 Query: 181 AGVSPGGGAWLGGQLFSAMVMRKPADAFLRELGVPYDEE 297 AGV+PGGGAWLGGQLFSAMVMRKPADAFLRE+GVPY++E Sbjct: 98 AGVAPGGGAWLGGQLFSAMVMRKPADAFLREIGVPYEDE 136 >ref|XP_007289177.1| thiazole biosynthetic enzyme [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406867568|gb|EKD20606.1| thiazole biosynthetic enzyme [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 327 Score = 181 bits (459), Expect = 9e-44 Identities = 88/99 (88%), Positives = 95/99 (95%) Frame = +1 Query: 1 FKFSAIRESQVSRAMTRRYFTDLDTYAESDIVIVGAGSCGLSSAYMLGKARPDLKIAIVE 180 FKF+ IRESQVSRAMTRRYF DLDTYAESDIVIVGAGSCGLS+AYMLGKARPDLKIAI+E Sbjct: 50 FKFTPIRESQVSRAMTRRYFNDLDTYAESDIVIVGAGSCGLSTAYMLGKARPDLKIAIIE 109 Query: 181 AGVSPGGGAWLGGQLFSAMVMRKPADAFLRELGVPYDEE 297 A VSPGGGAWLGGQLFSAMVMRKPADAFL +LGVP+++E Sbjct: 110 ASVSPGGGAWLGGQLFSAMVMRKPADAFLTDLGVPFEDE 148 >gb|EMD00030.1| hypothetical protein BAUCODRAFT_62660 [Baudoinia compniacensis UAMH 10762] Length = 315 Score = 181 bits (458), Expect = 1e-43 Identities = 87/99 (87%), Positives = 95/99 (95%) Frame = +1 Query: 1 FKFSAIRESQVSRAMTRRYFTDLDTYAESDIVIVGAGSCGLSSAYMLGKARPDLKIAIVE 180 F+F+ IRESQVSRAMTRRYF DLD Y ESDIVIVGAGSCGLSSAY+LGKARPDLKIAI+E Sbjct: 28 FQFAPIRESQVSRAMTRRYFADLDKYTESDIVIVGAGSCGLSSAYVLGKARPDLKIAIIE 87 Query: 181 AGVSPGGGAWLGGQLFSAMVMRKPADAFLRELGVPYDEE 297 AGV+PGGGAWLGGQLFSAMVMRKPADAFLRE+GVPY++E Sbjct: 88 AGVAPGGGAWLGGQLFSAMVMRKPADAFLREIGVPYEDE 126 >ref|XP_006666857.1| thiazole biosynthetic enzyme [Cordyceps militaris CM01] gi|346327384|gb|EGX96980.1| thiazole biosynthetic enzyme [Cordyceps militaris CM01] Length = 330 Score = 180 bits (457), Expect = 2e-43 Identities = 86/99 (86%), Positives = 95/99 (95%) Frame = +1 Query: 1 FKFSAIRESQVSRAMTRRYFTDLDTYAESDIVIVGAGSCGLSSAYMLGKARPDLKIAIVE 180 FKF+ IRESQVSRAMTRRYF DLDTYAESDIVI+GAGSCGLS+AY+LGK RPDLKIAI+E Sbjct: 49 FKFAPIRESQVSRAMTRRYFEDLDTYAESDIVIIGAGSCGLSAAYVLGKKRPDLKIAIIE 108 Query: 181 AGVSPGGGAWLGGQLFSAMVMRKPADAFLRELGVPYDEE 297 A VSPGGGAWLGGQLFSAM+MRKPADAFLRE+GVPY++E Sbjct: 109 ASVSPGGGAWLGGQLFSAMIMRKPADAFLREVGVPYEDE 147 >gb|EFY99491.1| thiazole biosynthetic enzyme variant 1 [Metarhizium anisopliae ARSEF 23] gi|594721578|gb|EXV04465.1| Thi4 family protein [Metarhizium robertsii] Length = 323 Score = 179 bits (455), Expect = 3e-43 Identities = 86/99 (86%), Positives = 94/99 (94%) Frame = +1 Query: 1 FKFSAIRESQVSRAMTRRYFTDLDTYAESDIVIVGAGSCGLSSAYMLGKARPDLKIAIVE 180 FKF+ IRESQVSRAMTRRYF DLDTYAESDIVI+GAGSCGLS+AY+LGK RPDLKI I+E Sbjct: 47 FKFAPIRESQVSRAMTRRYFKDLDTYAESDIVIIGAGSCGLSAAYVLGKQRPDLKICIIE 106 Query: 181 AGVSPGGGAWLGGQLFSAMVMRKPADAFLRELGVPYDEE 297 A VSPGGGAWLGGQLFSAMVMRKPADAFLRE+GVPY++E Sbjct: 107 ASVSPGGGAWLGGQLFSAMVMRKPADAFLREIGVPYEDE 145 >gb|ACN39013.1| thiazole synthase [Epichloe festucae] Length = 320 Score = 179 bits (455), Expect = 3e-43 Identities = 87/99 (87%), Positives = 94/99 (94%) Frame = +1 Query: 1 FKFSAIRESQVSRAMTRRYFTDLDTYAESDIVIVGAGSCGLSSAYMLGKARPDLKIAIVE 180 FKF+ IRESQVSRAMTRRYF DLDTYAESDIVIVGAGSCGLS+AY+LGK RPDLKI I+E Sbjct: 44 FKFAPIRESQVSRAMTRRYFQDLDTYAESDIVIVGAGSCGLSAAYVLGKHRPDLKICIIE 103 Query: 181 AGVSPGGGAWLGGQLFSAMVMRKPADAFLRELGVPYDEE 297 A VSPGGGAWLGGQLFSAMVMRKPADAFLRE+GVPY++E Sbjct: 104 ASVSPGGGAWLGGQLFSAMVMRKPADAFLREIGVPYEDE 142 >gb|ABN45974.1| thiazole biosynthetic enzyme variant 1 [Neotyphodium lolii] gi|125601844|gb|ABN45975.1| thiazole biosynthetic enzyme variant 2 [Neotyphodium lolii] gi|125601845|gb|ABN45976.1| thiazole biosynthetic enzyme variant 3 [Neotyphodium lolii] gi|125601846|gb|ABN45977.1| thiazole biosynthetic enzyme variant 4 [Neotyphodium lolii] gi|125601847|gb|ABN45978.1| thiazole biosynthetic enzyme variant 5 [Neotyphodium lolii] Length = 326 Score = 179 bits (455), Expect = 3e-43 Identities = 87/99 (87%), Positives = 94/99 (94%) Frame = +1 Query: 1 FKFSAIRESQVSRAMTRRYFTDLDTYAESDIVIVGAGSCGLSSAYMLGKARPDLKIAIVE 180 FKF+ IRESQVSRAMTRRYF DLDTYAESDIVIVGAGSCGLS+AY+LGK RPDLKI I+E Sbjct: 44 FKFAPIRESQVSRAMTRRYFQDLDTYAESDIVIVGAGSCGLSAAYVLGKHRPDLKICIIE 103 Query: 181 AGVSPGGGAWLGGQLFSAMVMRKPADAFLRELGVPYDEE 297 A VSPGGGAWLGGQLFSAMVMRKPADAFLRE+GVPY++E Sbjct: 104 ASVSPGGGAWLGGQLFSAMVMRKPADAFLREIGVPYEDE 142 >gb|ABN45968.1| thiazole biosynthetic enzyme variant 1 [Epichloe typhina] gi|125601828|gb|ABN45969.1| thiazole biosynthetic enzyme variant 2 [Epichloe typhina] gi|125601829|gb|ABN45970.1| thiazole biosynthetic enzyme variant 3 [Epichloe typhina] gi|125601830|gb|ABN45971.1| thiazole biosynthetic enzyme variant 4 [Epichloe typhina] gi|125601831|gb|ABN45972.1| thiazole biosynthetic enzyme variant 5 [Epichloe typhina] Length = 320 Score = 179 bits (455), Expect = 3e-43 Identities = 87/99 (87%), Positives = 94/99 (94%) Frame = +1 Query: 1 FKFSAIRESQVSRAMTRRYFTDLDTYAESDIVIVGAGSCGLSSAYMLGKARPDLKIAIVE 180 FKF+ IRESQVSRAMTRRYF DLDTYAESDIVIVGAGSCGLS+AY+LGK RPDLKI I+E Sbjct: 44 FKFAPIRESQVSRAMTRRYFRDLDTYAESDIVIVGAGSCGLSAAYVLGKHRPDLKICIIE 103 Query: 181 AGVSPGGGAWLGGQLFSAMVMRKPADAFLRELGVPYDEE 297 A VSPGGGAWLGGQLFSAMVMRKPADAFLRE+GVPY++E Sbjct: 104 ASVSPGGGAWLGGQLFSAMVMRKPADAFLREIGVPYEDE 142 >gb|EMF12655.1| thiazole biosynthetic enzyme, mitochondrial [Sphaerulina musiva SO2202] Length = 340 Score = 179 bits (454), Expect = 4e-43 Identities = 87/99 (87%), Positives = 95/99 (95%) Frame = +1 Query: 1 FKFSAIRESQVSRAMTRRYFTDLDTYAESDIVIVGAGSCGLSSAYMLGKARPDLKIAIVE 180 FKF+ IRESQVSRAMTRRYF+DLD YAESDIVIVGAGSCGLS+AY L KARPDLKIAIVE Sbjct: 53 FKFAHIRESQVSRAMTRRYFSDLDNYAESDIVIVGAGSCGLSAAYCLAKARPDLKIAIVE 112 Query: 181 AGVSPGGGAWLGGQLFSAMVMRKPADAFLRELGVPYDEE 297 AGV+PGGGAWLGGQLFSAM+MRKPADAFLRE+GVP++EE Sbjct: 113 AGVAPGGGAWLGGQLFSAMIMRKPADAFLREVGVPFEEE 151 >gb|EXK40264.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. melonis 26406] gi|590038407|gb|EXK40265.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. melonis 26406] gi|591443596|gb|EXL76153.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. conglutinans race 2 54008] Length = 373 Score = 178 bits (452), Expect = 6e-43 Identities = 85/99 (85%), Positives = 94/99 (94%) Frame = +1 Query: 1 FKFSAIRESQVSRAMTRRYFTDLDTYAESDIVIVGAGSCGLSSAYMLGKARPDLKIAIVE 180 FKF+ IRESQVSRAMTRRYF DLD YAESDIVI+GAGSCGLS+AY+LGK RPDLKIAI+E Sbjct: 97 FKFAPIRESQVSRAMTRRYFQDLDNYAESDIVIIGAGSCGLSAAYILGKKRPDLKIAIIE 156 Query: 181 AGVSPGGGAWLGGQLFSAMVMRKPADAFLRELGVPYDEE 297 A VSPGGGAWLGGQLFSAM+MRKPADAFLRE+GVPY++E Sbjct: 157 ASVSPGGGAWLGGQLFSAMIMRKPADAFLREVGVPYEDE 195 >gb|EWG49587.1| thiamine biosynthetic enzyme [Fusarium verticillioides 7600] gi|584140254|gb|EWG49588.1| thiamine biosynthetic enzyme [Fusarium verticillioides 7600] Length = 320 Score = 178 bits (452), Expect = 6e-43 Identities = 85/99 (85%), Positives = 94/99 (94%) Frame = +1 Query: 1 FKFSAIRESQVSRAMTRRYFTDLDTYAESDIVIVGAGSCGLSSAYMLGKARPDLKIAIVE 180 FKF+ IRESQVSRAMTRRYF DLD YAESDIVI+GAGSCGLS+AY+LGK RPDLKIAI+E Sbjct: 44 FKFAPIRESQVSRAMTRRYFQDLDNYAESDIVIIGAGSCGLSAAYILGKKRPDLKIAIIE 103 Query: 181 AGVSPGGGAWLGGQLFSAMVMRKPADAFLRELGVPYDEE 297 A VSPGGGAWLGGQLFSAM+MRKPADAFLRE+GVPY++E Sbjct: 104 ASVSPGGGAWLGGQLFSAMIMRKPADAFLREVGVPYEDE 142 >gb|EWG49586.1| thiamine biosynthetic enzyme [Fusarium verticillioides 7600] Length = 427 Score = 178 bits (452), Expect = 6e-43 Identities = 85/99 (85%), Positives = 94/99 (94%) Frame = +1 Query: 1 FKFSAIRESQVSRAMTRRYFTDLDTYAESDIVIVGAGSCGLSSAYMLGKARPDLKIAIVE 180 FKF+ IRESQVSRAMTRRYF DLD YAESDIVI+GAGSCGLS+AY+LGK RPDLKIAI+E Sbjct: 151 FKFAPIRESQVSRAMTRRYFQDLDNYAESDIVIIGAGSCGLSAAYILGKKRPDLKIAIIE 210 Query: 181 AGVSPGGGAWLGGQLFSAMVMRKPADAFLRELGVPYDEE 297 A VSPGGGAWLGGQLFSAM+MRKPADAFLRE+GVPY++E Sbjct: 211 ASVSPGGGAWLGGQLFSAMIMRKPADAFLREVGVPYEDE 249 >sp|P23618.2|THI4_FUSOX RecName: Full=Thiamine thiazole synthase; AltName: Full=Stress-inducible protein sti35; AltName: Full=Thiazole biosynthetic enzyme gi|544604719|sp|J9N5G7.1|THI4_FUSO4 RecName: Full=Thiamine thiazole synthase; AltName: Full=Stress-inducible protein sti35; AltName: Full=Thiazole biosynthetic enzyme gi|168164|gb|AAA33341.1| STI35 protein [Fusarium oxysporum] gi|6045153|dbj|BAA85305.1| sti35 [Fusarium oxysporum] gi|342887448|gb|EGU86946.1| hypothetical protein FOXB_02553 [Fusarium oxysporum Fo5176] gi|477513691|gb|ENH66155.1| Thiazole biosynthetic enzyme, mitochondrial [Fusarium oxysporum f. sp. cubense race 1] gi|517317785|emb|CCT68966.1| probable CyPBP37 protein (protein binding to CyP41) [Fusarium fujikuroi IMI 58289] gi|587669186|gb|EWY91527.1| thiamine biosynthetic enzyme [Fusarium oxysporum FOSC 3-a] gi|587669187|gb|EWY91528.1| thiamine biosynthetic enzyme [Fusarium oxysporum FOSC 3-a] gi|587669188|gb|EWY91529.1| thiamine biosynthetic enzyme [Fusarium oxysporum FOSC 3-a] gi|587669189|gb|EWY91530.1| thiamine biosynthetic enzyme [Fusarium oxysporum FOSC 3-a] gi|587669190|gb|EWY91531.1| thiamine biosynthetic enzyme [Fusarium oxysporum FOSC 3-a] gi|587669191|gb|EWY91532.1| thiamine biosynthetic enzyme [Fusarium oxysporum FOSC 3-a] gi|587669192|gb|EWY91533.1| thiamine biosynthetic enzyme [Fusarium oxysporum FOSC 3-a] gi|587691586|gb|EWZ38191.1| thiamine biosynthetic enzyme [Fusarium oxysporum Fo47] gi|587691587|gb|EWZ38192.1| thiamine biosynthetic enzyme [Fusarium oxysporum Fo47] gi|587691588|gb|EWZ38193.1| thiamine biosynthetic enzyme [Fusarium oxysporum Fo47] gi|587691589|gb|EWZ38194.1| thiamine biosynthetic enzyme [Fusarium oxysporum Fo47] gi|587691590|gb|EWZ38195.1| thiamine biosynthetic enzyme [Fusarium oxysporum Fo47] gi|587691591|gb|EWZ38196.1| thiamine biosynthetic enzyme [Fusarium oxysporum Fo47] gi|587691592|gb|EWZ38197.1| thiamine biosynthetic enzyme [Fusarium oxysporum Fo47] gi|587691593|gb|EWZ38198.1| thiamine biosynthetic enzyme [Fusarium oxysporum Fo47] gi|587711424|gb|EWZ82761.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. lycopersici MN25] gi|587711425|gb|EWZ82762.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. lycopersici MN25] gi|587711426|gb|EWZ82763.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. lycopersici MN25] gi|587711427|gb|EWZ82764.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. lycopersici MN25] gi|587711428|gb|EWZ82765.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. lycopersici MN25] gi|587711429|gb|EWZ82766.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. lycopersici MN25] gi|587711430|gb|EWZ82767.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. lycopersici MN25] gi|587711431|gb|EWZ82768.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. lycopersici MN25] gi|587748067|gb|EXA45783.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. pisi HDV247] gi|587748068|gb|EXA45784.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. pisi HDV247] gi|587748069|gb|EXA45785.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. pisi HDV247] gi|587748070|gb|EXA45786.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. pisi HDV247] gi|587748071|gb|EXA45787.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. pisi HDV247] gi|590038408|gb|EXK40266.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. melonis 26406] gi|590038409|gb|EXK40267.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. melonis 26406] gi|590038410|gb|EXK40268.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. melonis 26406] gi|590038411|gb|EXK40269.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. melonis 26406] gi|590038412|gb|EXK40270.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. melonis 26406] gi|590038413|gb|EXK40271.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. melonis 26406] gi|590064770|gb|EXK92294.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. raphani 54005] gi|590064771|gb|EXK92295.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. raphani 54005] gi|590064772|gb|EXK92296.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. raphani 54005] gi|590064773|gb|EXK92297.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. raphani 54005] gi|590064774|gb|EXK92298.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. raphani 54005] gi|591422521|gb|EXL57658.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. radicis-lycopersici 26381] gi|591422522|gb|EXL57659.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. radicis-lycopersici 26381] gi|591422523|gb|EXL57660.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. radicis-lycopersici 26381] gi|591422524|gb|EXL57661.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. radicis-lycopersici 26381] gi|591422525|gb|EXL57662.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. radicis-lycopersici 26381] gi|591422526|gb|EXL57663.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. radicis-lycopersici 26381] gi|591422527|gb|EXL57664.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. radicis-lycopersici 26381] gi|591443597|gb|EXL76154.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. conglutinans race 2 54008] gi|591443598|gb|EXL76155.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. conglutinans race 2 54008] gi|591443599|gb|EXL76156.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. conglutinans race 2 54008] gi|591443600|gb|EXL76157.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. conglutinans race 2 54008] gi|591465704|gb|EXL97128.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. cubense tropical race 4 54006] gi|591465705|gb|EXL97129.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. cubense tropical race 4 54006] gi|591465706|gb|EXL97130.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. cubense tropical race 4 54006] gi|591465707|gb|EXL97131.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. cubense tropical race 4 54006] gi|591465708|gb|EXL97132.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. cubense tropical race 4 54006] gi|591465709|gb|EXL97133.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. cubense tropical race 4 54006] gi|591465710|gb|EXL97134.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. cubense tropical race 4 54006] gi|591465711|gb|EXL97135.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. cubense tropical race 4 54006] gi|591493987|gb|EXM23548.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. vasinfectum 25433] gi|591493988|gb|EXM23549.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. vasinfectum 25433] gi|591493989|gb|EXM23550.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. vasinfectum 25433] gi|591493990|gb|EXM23551.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. vasinfectum 25433] gi|591493991|gb|EXM23552.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. vasinfectum 25433] Length = 320 Score = 178 bits (452), Expect = 6e-43 Identities = 85/99 (85%), Positives = 94/99 (94%) Frame = +1 Query: 1 FKFSAIRESQVSRAMTRRYFTDLDTYAESDIVIVGAGSCGLSSAYMLGKARPDLKIAIVE 180 FKF+ IRESQVSRAMTRRYF DLD YAESDIVI+GAGSCGLS+AY+LGK RPDLKIAI+E Sbjct: 44 FKFAPIRESQVSRAMTRRYFQDLDNYAESDIVIIGAGSCGLSAAYILGKKRPDLKIAIIE 103 Query: 181 AGVSPGGGAWLGGQLFSAMVMRKPADAFLRELGVPYDEE 297 A VSPGGGAWLGGQLFSAM+MRKPADAFLRE+GVPY++E Sbjct: 104 ASVSPGGGAWLGGQLFSAMIMRKPADAFLREVGVPYEDE 142 >gb|EPE26179.1| FAD/NAD(P)-binding protein [Glarea lozoyensis ATCC 20868] Length = 328 Score = 178 bits (452), Expect = 6e-43 Identities = 87/99 (87%), Positives = 93/99 (93%) Frame = +1 Query: 1 FKFSAIRESQVSRAMTRRYFTDLDTYAESDIVIVGAGSCGLSSAYMLGKARPDLKIAIVE 180 F F+ IRESQVSRAMTRRYF DLD YAESDIVIVGAGSCGLS+AYMLGKARPDLKIAI+E Sbjct: 51 FTFAPIRESQVSRAMTRRYFNDLDNYAESDIVIVGAGSCGLSTAYMLGKARPDLKIAIIE 110 Query: 181 AGVSPGGGAWLGGQLFSAMVMRKPADAFLRELGVPYDEE 297 A VSPGGGAWLGGQLFSAMVMRKPADAFL +LGVP+D+E Sbjct: 111 ASVSPGGGAWLGGQLFSAMVMRKPADAFLTDLGVPFDDE 149 >ref|XP_007586590.1| putative thiazole biosynthetic enzyme protein [Neofusicoccum parvum UCRNP2] gi|485919690|gb|EOD45932.1| putative thiazole biosynthetic enzyme protein [Neofusicoccum parvum UCRNP2] Length = 329 Score = 178 bits (452), Expect = 6e-43 Identities = 86/99 (86%), Positives = 95/99 (95%) Frame = +1 Query: 1 FKFSAIRESQVSRAMTRRYFTDLDTYAESDIVIVGAGSCGLSSAYMLGKARPDLKIAIVE 180 FKF+ IRESQVSRAMTRRYF DLDTYAESDIVIVGAGSCGLS+AYM+ KARPDLKIAI+E Sbjct: 49 FKFAPIRESQVSRAMTRRYFKDLDTYAESDIVIVGAGSCGLSTAYMIAKARPDLKIAIIE 108 Query: 181 AGVSPGGGAWLGGQLFSAMVMRKPADAFLRELGVPYDEE 297 +GV+PGGGAWLGGQLFSAMVMR+PADAFLRE+GV Y+EE Sbjct: 109 SGVAPGGGAWLGGQLFSAMVMRRPADAFLREVGVAYEEE 147 >gb|EMT70803.1| Thiazole biosynthetic enzyme, mitochondrial [Fusarium oxysporum f. sp. cubense race 4] Length = 337 Score = 178 bits (452), Expect = 6e-43 Identities = 85/99 (85%), Positives = 94/99 (94%) Frame = +1 Query: 1 FKFSAIRESQVSRAMTRRYFTDLDTYAESDIVIVGAGSCGLSSAYMLGKARPDLKIAIVE 180 FKF+ IRESQVSRAMTRRYF DLD YAESDIVI+GAGSCGLS+AY+LGK RPDLKIAI+E Sbjct: 61 FKFAPIRESQVSRAMTRRYFQDLDNYAESDIVIIGAGSCGLSAAYILGKKRPDLKIAIIE 120 Query: 181 AGVSPGGGAWLGGQLFSAMVMRKPADAFLRELGVPYDEE 297 A VSPGGGAWLGGQLFSAM+MRKPADAFLRE+GVPY++E Sbjct: 121 ASVSPGGGAWLGGQLFSAMIMRKPADAFLREVGVPYEDE 159 >gb|EME42084.1| hypothetical protein DOTSEDRAFT_73000 [Dothistroma septosporum NZE10] Length = 339 Score = 178 bits (452), Expect = 6e-43 Identities = 86/99 (86%), Positives = 94/99 (94%) Frame = +1 Query: 1 FKFSAIRESQVSRAMTRRYFTDLDTYAESDIVIVGAGSCGLSSAYMLGKARPDLKIAIVE 180 FKF+ IRESQVSRAMTRRYF DLD YAESDIVIVGAGSCGLS+AY L KARPDLKIAI+E Sbjct: 55 FKFAHIRESQVSRAMTRRYFADLDNYAESDIVIVGAGSCGLSTAYCLAKARPDLKIAIIE 114 Query: 181 AGVSPGGGAWLGGQLFSAMVMRKPADAFLRELGVPYDEE 297 AGV+PGGGAWLGGQLFSAMVMRKPADAFLRE+GVPY+++ Sbjct: 115 AGVAPGGGAWLGGQLFSAMVMRKPADAFLREIGVPYEDD 153 >gb|EKJ77843.1| hypothetical protein FPSE_01936 [Fusarium pseudograminearum CS3096] Length = 322 Score = 178 bits (452), Expect = 6e-43 Identities = 85/99 (85%), Positives = 94/99 (94%) Frame = +1 Query: 1 FKFSAIRESQVSRAMTRRYFTDLDTYAESDIVIVGAGSCGLSSAYMLGKARPDLKIAIVE 180 FKF+ IRESQVSRAMTRRYF DLD YAESDIVI+GAGSCGLS+AY+LGK RPDLKIAI+E Sbjct: 46 FKFAPIRESQVSRAMTRRYFQDLDNYAESDIVIIGAGSCGLSAAYILGKKRPDLKIAIIE 105 Query: 181 AGVSPGGGAWLGGQLFSAMVMRKPADAFLRELGVPYDEE 297 A VSPGGGAWLGGQLFSAM+MRKPADAFLRE+GVPY++E Sbjct: 106 ASVSPGGGAWLGGQLFSAMIMRKPADAFLREVGVPYEDE 144 >gb|EHL02685.1| putative Thiazole biosynthetic enzyme, mitochondrial [Glarea lozoyensis 74030] Length = 322 Score = 178 bits (452), Expect = 6e-43 Identities = 87/99 (87%), Positives = 93/99 (93%) Frame = +1 Query: 1 FKFSAIRESQVSRAMTRRYFTDLDTYAESDIVIVGAGSCGLSSAYMLGKARPDLKIAIVE 180 F F+ IRESQVSRAMTRRYF DLD YAESDIVIVGAGSCGLS+AYMLGKARPDLKIAI+E Sbjct: 45 FTFAPIRESQVSRAMTRRYFNDLDNYAESDIVIVGAGSCGLSTAYMLGKARPDLKIAIIE 104 Query: 181 AGVSPGGGAWLGGQLFSAMVMRKPADAFLRELGVPYDEE 297 A VSPGGGAWLGGQLFSAMVMRKPADAFL +LGVP+D+E Sbjct: 105 ASVSPGGGAWLGGQLFSAMVMRKPADAFLTDLGVPFDDE 143 >ref|XP_001549602.1| thiazole biosynthetic enzyme [Botryotinia fuckeliana B05.10] gi|347840794|emb|CCD55366.1| similar to thiazole biosynthetic enzyme [Botryotinia fuckeliana T4] gi|472239902|gb|EMR84691.1| putative thiazole biosynthetic enzyme protein [Botryotinia fuckeliana BcDW1] Length = 328 Score = 178 bits (452), Expect = 6e-43 Identities = 86/99 (86%), Positives = 94/99 (94%) Frame = +1 Query: 1 FKFSAIRESQVSRAMTRRYFTDLDTYAESDIVIVGAGSCGLSSAYMLGKARPDLKIAIVE 180 F F+ IRESQVSRAMTRRYF DLDTYAESDIVIVGAGSCGLS+AYMLGKARPDLKIA++E Sbjct: 51 FTFAPIRESQVSRAMTRRYFNDLDTYAESDIVIVGAGSCGLSTAYMLGKARPDLKIAVIE 110 Query: 181 AGVSPGGGAWLGGQLFSAMVMRKPADAFLRELGVPYDEE 297 A VSPGGGAWLGGQLFSAMVMRKPADAFL +LGVP+++E Sbjct: 111 ASVSPGGGAWLGGQLFSAMVMRKPADAFLTDLGVPFEDE 149