BLASTX nr result
ID: Akebia23_contig00060349
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00060349 (465 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN62375.1| hypothetical protein VITISV_028920 [Vitis vinifera] 47 8e-06 >emb|CAN62375.1| hypothetical protein VITISV_028920 [Vitis vinifera] Length = 843 Score = 46.6 bits (109), Expect(2) = 8e-06 Identities = 19/47 (40%), Positives = 30/47 (63%) Frame = -1 Query: 450 KKRDFQMPNCCVMCMGCVERVDRLLLHCAIAQLMRSHYLRLFGMEGV 310 ++R +Q+PNCC +C E VD LL+HC + +++ L LFG+ V Sbjct: 448 QRRGWQLPNCCFLCGSEEESVDHLLIHCIVVRVLWDLVLALFGVHWV 494 Score = 28.5 bits (62), Expect(2) = 8e-06 Identities = 31/117 (26%), Positives = 48/117 (41%), Gaps = 26/117 (22%) Frame = -3 Query: 307 PRTVRELFEL*LFWGSP-LGCSKRVLCSLLPFAICSGLWKEGNKRIFEG----------- 164 P TV+++ L W P +G ++ + +P I +WKE N+ F G Sbjct: 496 PETVKKVL---LSWRGPFVGKKRKKIWKSIPLYIFWTVWKERNRLAFRGVCSNESVNEVW 552 Query: 163 --------------KDSPSQEIFL*VSGLLFFGERLLKS*RGLFFEDFVVWWHFDCN 35 +DS E+ L + LLF LL++ R ED V+W DC+ Sbjct: 553 DPRLGQGGWNLRLARDSNDWELVL-IEDLLF----LLRNIRVTPEEDSVLWKGGDCD 604