BLASTX nr result
ID: Akebia23_contig00058494
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00058494 (221 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ETS82081.1| Mitochondrial outer membrane protein porin [Pesta... 90 3e-16 gb|EOO03440.1| putative outer mitochondrial membrane protein por... 89 6e-16 gb|EMR66755.1| putative outer mitochondrial membrane protein por... 89 6e-16 emb|CCC12405.1| unnamed protein product [Sordaria macrospora k-h... 88 1e-15 ref|XP_006696619.1| hypothetical protein CTHT_0063120 [Chaetomiu... 88 1e-15 ref|XP_003349299.1| hypothetical protein SMAC_05582 [Sordaria ma... 88 1e-15 ref|XP_003649876.1| hypothetical protein THITE_2108942 [Thielavi... 87 2e-15 ref|XP_960950.1| outer mitochondrial membrane protein porin [Neu... 87 3e-15 ref|XP_003662266.1| hypothetical protein MYCTH_2302705 [Myceliop... 86 4e-15 ref|XP_001224701.1| outer mitochondrial membrane protein porin [... 84 2e-14 gb|EPE36840.1| outer mitochondrial membrane protein porin [Glare... 84 2e-14 gb|EHK99176.1| putative Mitochondrial outer membrane protein por... 84 2e-14 gb|EFX04452.1| outer mitochondrial membrane protein porin [Grosm... 84 2e-14 gb|ESZ97574.1| outer mitochondrial membrane protein porin [Scler... 83 3e-14 ref|XP_007601874.1| mitochondrial outer membrane protein porin [... 83 4e-14 gb|ERT02954.1| mitochondrial outer membrane protein porin [Sporo... 83 4e-14 gb|ENH81710.1| outer mitochondrial membrane protein porin [Colle... 83 4e-14 emb|CCF36844.1| mitochondrial outer membrane protein porin [Coll... 83 4e-14 gb|EGY13590.1| outer mitochondrial membrane protein porin [Verti... 83 4e-14 gb|EFQ28976.1| eukaryotic porin [Colletotrichum graminicola M1.001] 83 4e-14 >gb|ETS82081.1| Mitochondrial outer membrane protein porin [Pestalotiopsis fici W106-1] Length = 356 Score = 90.1 bits (222), Expect = 3e-16 Identities = 44/46 (95%), Positives = 44/46 (95%) Frame = +1 Query: 82 MSVPAFSDISKSANDLLNKDFYHLSASTIEVKSNTPNNVAFKVVGK 219 MSVPAFSDISKSANDLLNKDFYHLSA TIEVKSNTPNNVAFKV GK Sbjct: 1 MSVPAFSDISKSANDLLNKDFYHLSAGTIEVKSNTPNNVAFKVTGK 46 >gb|EOO03440.1| putative outer mitochondrial membrane protein porin protein [Togninia minima UCRPA7] Length = 335 Score = 89.0 bits (219), Expect = 6e-16 Identities = 43/46 (93%), Positives = 44/46 (95%) Frame = +1 Query: 82 MSVPAFSDISKSANDLLNKDFYHLSASTIEVKSNTPNNVAFKVVGK 219 MSVPAFSDI+KSANDLLNKDFYHLSA TIEVKSNTPNNVAFKV GK Sbjct: 1 MSVPAFSDIAKSANDLLNKDFYHLSAGTIEVKSNTPNNVAFKVTGK 46 >gb|EMR66755.1| putative outer mitochondrial membrane protein porin protein [Eutypa lata UCREL1] Length = 283 Score = 89.0 bits (219), Expect = 6e-16 Identities = 43/46 (93%), Positives = 44/46 (95%) Frame = +1 Query: 82 MSVPAFSDISKSANDLLNKDFYHLSASTIEVKSNTPNNVAFKVVGK 219 MSVPAF+DISKSANDLLNKDFYHLSA TIEVKSNTPNNVAFKV GK Sbjct: 1 MSVPAFADISKSANDLLNKDFYHLSAGTIEVKSNTPNNVAFKVTGK 46 >emb|CCC12405.1| unnamed protein product [Sordaria macrospora k-hell] Length = 283 Score = 87.8 bits (216), Expect = 1e-15 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = +1 Query: 82 MSVPAFSDISKSANDLLNKDFYHLSASTIEVKSNTPNNVAFKVVGK 219 M+VPAFSDI+KSANDLLNKDFYHLSA TIEVKSNTPNNVAFKV GK Sbjct: 1 MAVPAFSDIAKSANDLLNKDFYHLSAGTIEVKSNTPNNVAFKVTGK 46 >ref|XP_006696619.1| hypothetical protein CTHT_0063120 [Chaetomium thermophilum var. thermophilum DSM 1495] gi|340914947|gb|EGS18288.1| hypothetical protein CTHT_0063120 [Chaetomium thermophilum var. thermophilum DSM 1495] Length = 283 Score = 87.8 bits (216), Expect = 1e-15 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = +1 Query: 82 MSVPAFSDISKSANDLLNKDFYHLSASTIEVKSNTPNNVAFKVVGK 219 MSVPAFSDI+K+ANDLLNKDFYHLSA TIEVKSNTPNNVAFKV GK Sbjct: 1 MSVPAFSDIAKAANDLLNKDFYHLSAGTIEVKSNTPNNVAFKVTGK 46 >ref|XP_003349299.1| hypothetical protein SMAC_05582 [Sordaria macrospora k-hell] Length = 426 Score = 87.8 bits (216), Expect = 1e-15 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = +1 Query: 82 MSVPAFSDISKSANDLLNKDFYHLSASTIEVKSNTPNNVAFKVVGK 219 M+VPAFSDI+KSANDLLNKDFYHLSA TIEVKSNTPNNVAFKV GK Sbjct: 1 MAVPAFSDIAKSANDLLNKDFYHLSAGTIEVKSNTPNNVAFKVTGK 46 >ref|XP_003649876.1| hypothetical protein THITE_2108942 [Thielavia terrestris NRRL 8126] gi|346997137|gb|AEO63540.1| hypothetical protein THITE_2108942 [Thielavia terrestris NRRL 8126] Length = 283 Score = 87.0 bits (214), Expect = 2e-15 Identities = 41/46 (89%), Positives = 44/46 (95%) Frame = +1 Query: 82 MSVPAFSDISKSANDLLNKDFYHLSASTIEVKSNTPNNVAFKVVGK 219 MSVPAFSDI+K+ANDLLNKDFYHLSA T+EVKSNTPNNVAFKV GK Sbjct: 1 MSVPAFSDIAKAANDLLNKDFYHLSAGTLEVKSNTPNNVAFKVTGK 46 >ref|XP_960950.1| outer mitochondrial membrane protein porin [Neurospora crassa OR74A] gi|130684|sp|P07144.1|VDAC_NEUCR RecName: Full=Mitochondrial outer membrane protein porin gi|3057|emb|CAA29264.1| unnamed protein product [Neurospora crassa] gi|28922484|gb|EAA31714.1| outer mitochondrial membrane protein porin [Neurospora crassa OR74A] gi|28950165|emb|CAD71033.1| mitochondrial porin [Neurospora crassa] gi|336472097|gb|EGO60257.1| Mitochondrial outer membrane protein porin [Neurospora tetrasperma FGSC 2508] gi|350294696|gb|EGZ75781.1| mitochondrial outer membrane protein porin [Neurospora tetrasperma FGSC 2509] Length = 283 Score = 86.7 bits (213), Expect = 3e-15 Identities = 41/46 (89%), Positives = 44/46 (95%) Frame = +1 Query: 82 MSVPAFSDISKSANDLLNKDFYHLSASTIEVKSNTPNNVAFKVVGK 219 M+VPAFSDI+KSANDLLNKDFYHL+A TIEVKSNTPNNVAFKV GK Sbjct: 1 MAVPAFSDIAKSANDLLNKDFYHLAAGTIEVKSNTPNNVAFKVTGK 46 >ref|XP_003662266.1| hypothetical protein MYCTH_2302705 [Myceliophthora thermophila ATCC 42464] gi|347009534|gb|AEO57021.1| hypothetical protein MYCTH_2302705 [Myceliophthora thermophila ATCC 42464] Length = 283 Score = 86.3 bits (212), Expect = 4e-15 Identities = 41/46 (89%), Positives = 43/46 (93%) Frame = +1 Query: 82 MSVPAFSDISKSANDLLNKDFYHLSASTIEVKSNTPNNVAFKVVGK 219 MSVPAF DI+K+ANDLLNKDFYHLSA TIEVKSNTPNNVAFKV GK Sbjct: 1 MSVPAFQDIAKAANDLLNKDFYHLSAGTIEVKSNTPNNVAFKVTGK 46 >ref|XP_001224701.1| outer mitochondrial membrane protein porin [Chaetomium globosum CBS 148.51] gi|88178324|gb|EAQ85792.1| outer mitochondrial membrane protein porin [Chaetomium globosum CBS 148.51] Length = 283 Score = 84.3 bits (207), Expect = 2e-14 Identities = 39/46 (84%), Positives = 43/46 (93%) Frame = +1 Query: 82 MSVPAFSDISKSANDLLNKDFYHLSASTIEVKSNTPNNVAFKVVGK 219 MSVP+F DI+K+ANDLLNKDFYHLSA T+EVKSNTPNNVAFKV GK Sbjct: 1 MSVPSFQDIAKAANDLLNKDFYHLSAGTLEVKSNTPNNVAFKVTGK 46 >gb|EPE36840.1| outer mitochondrial membrane protein porin [Glarea lozoyensis ATCC 20868] Length = 327 Score = 84.3 bits (207), Expect = 2e-14 Identities = 39/46 (84%), Positives = 44/46 (95%) Frame = +1 Query: 82 MSVPAFSDISKSANDLLNKDFYHLSASTIEVKSNTPNNVAFKVVGK 219 MSVPAF+DI+KS+NDLLNKDFYHLSA+ +EVKSNTPNNVAFKV GK Sbjct: 1 MSVPAFTDIAKSSNDLLNKDFYHLSAAALEVKSNTPNNVAFKVTGK 46 >gb|EHK99176.1| putative Mitochondrial outer membrane protein porin [Glarea lozoyensis 74030] Length = 267 Score = 84.3 bits (207), Expect = 2e-14 Identities = 39/46 (84%), Positives = 44/46 (95%) Frame = +1 Query: 82 MSVPAFSDISKSANDLLNKDFYHLSASTIEVKSNTPNNVAFKVVGK 219 MSVPAF+DI+KS+NDLLNKDFYHLSA+ +EVKSNTPNNVAFKV GK Sbjct: 1 MSVPAFTDIAKSSNDLLNKDFYHLSAAALEVKSNTPNNVAFKVTGK 46 >gb|EFX04452.1| outer mitochondrial membrane protein porin [Grosmannia clavigera kw1407] Length = 428 Score = 84.0 bits (206), Expect = 2e-14 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = +1 Query: 82 MSVPAFSDISKSANDLLNKDFYHLSASTIEVKSNTPNNVAFKVVGK 219 MSVP FSDI+K+ANDLLNKDFYHLSA T+EVKSNTPNNVAFKV GK Sbjct: 1 MSVPNFSDIAKAANDLLNKDFYHLSAGTLEVKSNTPNNVAFKVSGK 46 >gb|ESZ97574.1| outer mitochondrial membrane protein porin [Sclerotinia borealis F-4157] Length = 311 Score = 83.2 bits (204), Expect = 3e-14 Identities = 38/46 (82%), Positives = 44/46 (95%) Frame = +1 Query: 82 MSVPAFSDISKSANDLLNKDFYHLSASTIEVKSNTPNNVAFKVVGK 219 MSVPAF+DI+KS+NDLLNKDFYHL+A+ +EVKSNTPNNVAFKV GK Sbjct: 1 MSVPAFTDIAKSSNDLLNKDFYHLNAAALEVKSNTPNNVAFKVTGK 46 >ref|XP_007601874.1| mitochondrial outer membrane protein porin [Colletotrichum fioriniae PJ7] gi|588892062|gb|EXF74474.1| mitochondrial outer membrane protein porin [Colletotrichum fioriniae PJ7] Length = 336 Score = 82.8 bits (203), Expect = 4e-14 Identities = 39/46 (84%), Positives = 42/46 (91%) Frame = +1 Query: 82 MSVPAFSDISKSANDLLNKDFYHLSASTIEVKSNTPNNVAFKVVGK 219 MSVP F DI+KSANDLLNKDFYHLSA+T E+KSNTPNNVAFKV GK Sbjct: 1 MSVPNFGDIAKSANDLLNKDFYHLSATTFELKSNTPNNVAFKVTGK 46 >gb|ERT02954.1| mitochondrial outer membrane protein porin [Sporothrix schenckii ATCC 58251] Length = 411 Score = 82.8 bits (203), Expect = 4e-14 Identities = 40/46 (86%), Positives = 42/46 (91%) Frame = +1 Query: 82 MSVPAFSDISKSANDLLNKDFYHLSASTIEVKSNTPNNVAFKVVGK 219 MSVP FSDI+K ANDLLNKDFYHLSA T+EVKSNTPNNVAFKV GK Sbjct: 1 MSVPNFSDIAKPANDLLNKDFYHLSAGTLEVKSNTPNNVAFKVNGK 46 >gb|ENH81710.1| outer mitochondrial membrane protein porin [Colletotrichum orbiculare MAFF 240422] Length = 337 Score = 82.8 bits (203), Expect = 4e-14 Identities = 39/46 (84%), Positives = 42/46 (91%) Frame = +1 Query: 82 MSVPAFSDISKSANDLLNKDFYHLSASTIEVKSNTPNNVAFKVVGK 219 MSVP F DI+KSANDLLNKDFYHLSA+T E+KSNTPNNVAFKV GK Sbjct: 1 MSVPNFGDIAKSANDLLNKDFYHLSATTFELKSNTPNNVAFKVTGK 46 >emb|CCF36844.1| mitochondrial outer membrane protein porin [Colletotrichum higginsianum] Length = 288 Score = 82.8 bits (203), Expect = 4e-14 Identities = 39/46 (84%), Positives = 42/46 (91%) Frame = +1 Query: 82 MSVPAFSDISKSANDLLNKDFYHLSASTIEVKSNTPNNVAFKVVGK 219 MSVP F DI+KSANDLLNKDFYHLSA+T E+KSNTPNNVAFKV GK Sbjct: 1 MSVPNFGDIAKSANDLLNKDFYHLSATTFELKSNTPNNVAFKVTGK 46 >gb|EGY13590.1| outer mitochondrial membrane protein porin [Verticillium dahliae VdLs.17] Length = 283 Score = 82.8 bits (203), Expect = 4e-14 Identities = 38/46 (82%), Positives = 44/46 (95%) Frame = +1 Query: 82 MSVPAFSDISKSANDLLNKDFYHLSASTIEVKSNTPNNVAFKVVGK 219 MSVP F+DI+K++NDLLNKDFYHLSA+T+EVKSNTPNNVAFKV GK Sbjct: 1 MSVPNFADIAKASNDLLNKDFYHLSAATLEVKSNTPNNVAFKVTGK 46 >gb|EFQ28976.1| eukaryotic porin [Colletotrichum graminicola M1.001] Length = 288 Score = 82.8 bits (203), Expect = 4e-14 Identities = 39/46 (84%), Positives = 42/46 (91%) Frame = +1 Query: 82 MSVPAFSDISKSANDLLNKDFYHLSASTIEVKSNTPNNVAFKVVGK 219 MSVP F DI+KSANDLLNKDFYHLSA+T E+KSNTPNNVAFKV GK Sbjct: 1 MSVPNFGDIAKSANDLLNKDFYHLSATTFELKSNTPNNVAFKVTGK 46