BLASTX nr result
ID: Akebia23_contig00058011
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00058011 (342 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG17748.1| Ornithine decarboxylase antizyme [Macrophomina ph... 58 1e-06 ref|XP_007588985.1| putative ornithine decarboxylase antizyme pr... 57 2e-06 gb|EON67856.1| hypothetical protein W97_07353 [Coniosporium apol... 57 3e-06 >gb|EKG17748.1| Ornithine decarboxylase antizyme [Macrophomina phaseolina MS6] Length = 161 Score = 58.2 bits (139), Expect = 1e-06 Identities = 23/38 (60%), Positives = 30/38 (78%) Frame = -2 Query: 341 KGLTHDLGWAGFEPLTLVDWTKSDDIISNRWIFLGVEV 228 K L DLGW GFEP+TL +WT++ I+S +WIFLG+EV Sbjct: 124 KALIKDLGWIGFEPVTLAEWTETPPIVSEKWIFLGMEV 161 >ref|XP_007588985.1| putative ornithine decarboxylase antizyme protein [Neofusicoccum parvum UCRNP2] gi|485916133|gb|EOD43536.1| putative ornithine decarboxylase antizyme protein [Neofusicoccum parvum UCRNP2] Length = 151 Score = 57.4 bits (137), Expect = 2e-06 Identities = 22/38 (57%), Positives = 29/38 (76%) Frame = -2 Query: 341 KGLTHDLGWAGFEPLTLVDWTKSDDIISNRWIFLGVEV 228 KGL DLGW GFEP+TL +W + I+S+ W+FLG+EV Sbjct: 114 KGLMKDLGWIGFEPITLAEWAEKPPIVSDAWVFLGMEV 151 >gb|EON67856.1| hypothetical protein W97_07353 [Coniosporium apollinis CBS 100218] Length = 278 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/38 (60%), Positives = 30/38 (78%) Frame = -2 Query: 341 KGLTHDLGWAGFEPLTLVDWTKSDDIISNRWIFLGVEV 228 K L DLGW GFE +TL WT S++IIS+RW+FLG++V Sbjct: 241 KALMRDLGWVGFEAVTLARWTHSNEIISDRWVFLGMDV 278