BLASTX nr result
ID: Akebia23_contig00056031
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00056031 (466 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007039721.1| Tetratricopeptide repeat (TPR)-like superfam... 127 2e-27 ref|XP_004165812.1| PREDICTED: pentatricopeptide repeat-containi... 127 2e-27 ref|XP_004147229.1| PREDICTED: pentatricopeptide repeat-containi... 127 2e-27 ref|XP_006477110.1| PREDICTED: pentatricopeptide repeat-containi... 126 3e-27 ref|XP_006440204.1| hypothetical protein CICLE_v10019492mg [Citr... 126 3e-27 ref|XP_002265980.2| PREDICTED: pentatricopeptide repeat-containi... 125 5e-27 emb|CBI23541.3| unnamed protein product [Vitis vinifera] 125 5e-27 ref|XP_004301739.1| PREDICTED: pentatricopeptide repeat-containi... 125 6e-27 ref|XP_007210130.1| hypothetical protein PRUPE_ppa022577mg [Prun... 124 1e-26 ref|XP_002961361.1| hypothetical protein SELMODRAFT_76175 [Selag... 124 1e-26 ref|XP_002980913.1| hypothetical protein SELMODRAFT_113567 [Sela... 124 1e-26 ref|XP_007155703.1| hypothetical protein PHAVU_003G224100g [Phas... 124 2e-26 ref|XP_004972826.1| PREDICTED: pentatricopeptide repeat-containi... 122 4e-26 ref|XP_004508953.1| PREDICTED: pentatricopeptide repeat-containi... 122 4e-26 ref|XP_006282848.1| hypothetical protein CARUB_v10006791mg [Caps... 122 4e-26 ref|XP_006359230.1| PREDICTED: pentatricopeptide repeat-containi... 122 5e-26 ref|XP_002303374.2| hypothetical protein POPTR_0003s07960g [Popu... 122 5e-26 ref|NP_680717.2| pentatricopeptide repeat-containing protein [Ar... 122 7e-26 ref|XP_006578628.1| PREDICTED: pentatricopeptide repeat-containi... 121 9e-26 ref|XP_006414294.1| hypothetical protein EUTSA_v10024626mg [Eutr... 121 9e-26 >ref|XP_007039721.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] gi|508776966|gb|EOY24222.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] Length = 685 Score = 127 bits (319), Expect = 2e-27 Identities = 59/68 (86%), Positives = 61/68 (89%) Frame = -3 Query: 464 SEKLAIAFGLISTPSGTRIRVFKNLRVCGDCHNAIKYISAIEGREIIVRDTTRFHHFRNG 285 SEKLAIAFGLI PSG IRVFKNLRVCGDCH AIKYISAIE REIIVRDT RFHHF++G Sbjct: 618 SEKLAIAFGLIKVPSGGPIRVFKNLRVCGDCHRAIKYISAIETREIIVRDTVRFHHFKDG 677 Query: 284 SCSCGDYW 261 SCSCGDYW Sbjct: 678 SCSCGDYW 685 >ref|XP_004165812.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16835, mitochondrial-like [Cucumis sativus] Length = 667 Score = 127 bits (318), Expect = 2e-27 Identities = 59/68 (86%), Positives = 61/68 (89%) Frame = -3 Query: 464 SEKLAIAFGLISTPSGTRIRVFKNLRVCGDCHNAIKYISAIEGREIIVRDTTRFHHFRNG 285 SEKLAIAFGL+ T GT IRVFKNLRVCGDCH AIK+ISAIE REIIVRDTTRFHHFRNG Sbjct: 600 SEKLAIAFGLMKTAPGTPIRVFKNLRVCGDCHRAIKFISAIEKREIIVRDTTRFHHFRNG 659 Query: 284 SCSCGDYW 261 CSCGDYW Sbjct: 660 FCSCGDYW 667 >ref|XP_004147229.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16835, mitochondrial-like [Cucumis sativus] Length = 667 Score = 127 bits (318), Expect = 2e-27 Identities = 59/68 (86%), Positives = 61/68 (89%) Frame = -3 Query: 464 SEKLAIAFGLISTPSGTRIRVFKNLRVCGDCHNAIKYISAIEGREIIVRDTTRFHHFRNG 285 SEKLAIAFGL+ T GT IRVFKNLRVCGDCH AIK+ISAIE REIIVRDTTRFHHFRNG Sbjct: 600 SEKLAIAFGLMKTAPGTPIRVFKNLRVCGDCHRAIKFISAIEKREIIVRDTTRFHHFRNG 659 Query: 284 SCSCGDYW 261 CSCGDYW Sbjct: 660 FCSCGDYW 667 >ref|XP_006477110.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16835, mitochondrial-like [Citrus sinensis] Length = 669 Score = 126 bits (317), Expect = 3e-27 Identities = 58/68 (85%), Positives = 61/68 (89%) Frame = -3 Query: 464 SEKLAIAFGLISTPSGTRIRVFKNLRVCGDCHNAIKYISAIEGREIIVRDTTRFHHFRNG 285 SEKLAIAFGLI P GT IRVFKNLRVCGDCH A KYISAIE REIIVRDTTRFHHF++G Sbjct: 602 SEKLAIAFGLIKVPLGTPIRVFKNLRVCGDCHRATKYISAIEKREIIVRDTTRFHHFKDG 661 Query: 284 SCSCGDYW 261 +CSCGDYW Sbjct: 662 TCSCGDYW 669 >ref|XP_006440204.1| hypothetical protein CICLE_v10019492mg [Citrus clementina] gi|557542466|gb|ESR53444.1| hypothetical protein CICLE_v10019492mg [Citrus clementina] Length = 571 Score = 126 bits (317), Expect = 3e-27 Identities = 58/68 (85%), Positives = 61/68 (89%) Frame = -3 Query: 464 SEKLAIAFGLISTPSGTRIRVFKNLRVCGDCHNAIKYISAIEGREIIVRDTTRFHHFRNG 285 SEKLAIAFGLI P GT IRVFKNLRVCGDCH A KYISAIE REIIVRDTTRFHHF++G Sbjct: 504 SEKLAIAFGLIKVPLGTPIRVFKNLRVCGDCHRATKYISAIEKREIIVRDTTRFHHFKDG 563 Query: 284 SCSCGDYW 261 +CSCGDYW Sbjct: 564 TCSCGDYW 571 >ref|XP_002265980.2| PREDICTED: pentatricopeptide repeat-containing protein At4g16835, mitochondrial-like, partial [Vitis vinifera] Length = 599 Score = 125 bits (315), Expect = 5e-27 Identities = 58/68 (85%), Positives = 60/68 (88%) Frame = -3 Query: 464 SEKLAIAFGLISTPSGTRIRVFKNLRVCGDCHNAIKYISAIEGREIIVRDTTRFHHFRNG 285 SEKLAIA+GLI P GT IRVFKNLRVCGDCH+A KYISAIEGR IIVRDTTRFHHFR G Sbjct: 532 SEKLAIAYGLIRMPLGTPIRVFKNLRVCGDCHSATKYISAIEGRVIIVRDTTRFHHFRQG 591 Query: 284 SCSCGDYW 261 CSCGDYW Sbjct: 592 ECSCGDYW 599 >emb|CBI23541.3| unnamed protein product [Vitis vinifera] Length = 385 Score = 125 bits (315), Expect = 5e-27 Identities = 58/68 (85%), Positives = 60/68 (88%) Frame = -3 Query: 464 SEKLAIAFGLISTPSGTRIRVFKNLRVCGDCHNAIKYISAIEGREIIVRDTTRFHHFRNG 285 SEKLAIA+GLI P GT IRVFKNLRVCGDCH+A KYISAIEGR IIVRDTTRFHHFR G Sbjct: 318 SEKLAIAYGLIRMPLGTPIRVFKNLRVCGDCHSATKYISAIEGRVIIVRDTTRFHHFRQG 377 Query: 284 SCSCGDYW 261 CSCGDYW Sbjct: 378 ECSCGDYW 385 >ref|XP_004301739.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16835, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 669 Score = 125 bits (314), Expect = 6e-27 Identities = 57/68 (83%), Positives = 61/68 (89%) Frame = -3 Query: 464 SEKLAIAFGLISTPSGTRIRVFKNLRVCGDCHNAIKYISAIEGREIIVRDTTRFHHFRNG 285 SEKLAIAFGLI PSGT IR+FKNLRVCGDCH+AIKYIS IE REII+RDTTRFH F+NG Sbjct: 602 SEKLAIAFGLIHVPSGTPIRIFKNLRVCGDCHHAIKYISVIEKREIILRDTTRFHQFKNG 661 Query: 284 SCSCGDYW 261 CSCGDYW Sbjct: 662 VCSCGDYW 669 >ref|XP_007210130.1| hypothetical protein PRUPE_ppa022577mg [Prunus persica] gi|462405865|gb|EMJ11329.1| hypothetical protein PRUPE_ppa022577mg [Prunus persica] Length = 569 Score = 124 bits (312), Expect = 1e-26 Identities = 57/68 (83%), Positives = 60/68 (88%) Frame = -3 Query: 464 SEKLAIAFGLISTPSGTRIRVFKNLRVCGDCHNAIKYISAIEGREIIVRDTTRFHHFRNG 285 SEKLAIAFGLI P GT IR+FKNLRVCGDCH+A KYISAIE REIIVRDTTRFHHF+ G Sbjct: 502 SEKLAIAFGLIKMPLGTPIRIFKNLRVCGDCHHATKYISAIEKREIIVRDTTRFHHFKGG 561 Query: 284 SCSCGDYW 261 CSCGDYW Sbjct: 562 VCSCGDYW 569 >ref|XP_002961361.1| hypothetical protein SELMODRAFT_76175 [Selaginella moellendorffii] gi|300170020|gb|EFJ36621.1| hypothetical protein SELMODRAFT_76175 [Selaginella moellendorffii] Length = 1121 Score = 124 bits (311), Expect = 1e-26 Identities = 53/68 (77%), Positives = 61/68 (89%) Frame = -3 Query: 464 SEKLAIAFGLISTPSGTRIRVFKNLRVCGDCHNAIKYISAIEGREIIVRDTTRFHHFRNG 285 SEKLA+AFG++STP G+ +R+ KNLR CGDCH AIK ISAIEGREI+VRD+ RFHHFRNG Sbjct: 1054 SEKLAVAFGVLSTPPGSSLRIIKNLRACGDCHTAIKLISAIEGREIVVRDSNRFHHFRNG 1113 Query: 284 SCSCGDYW 261 SCSCGDYW Sbjct: 1114 SCSCGDYW 1121 >ref|XP_002980913.1| hypothetical protein SELMODRAFT_113567 [Selaginella moellendorffii] gi|300151452|gb|EFJ18098.1| hypothetical protein SELMODRAFT_113567 [Selaginella moellendorffii] Length = 809 Score = 124 bits (311), Expect = 1e-26 Identities = 53/68 (77%), Positives = 61/68 (89%) Frame = -3 Query: 464 SEKLAIAFGLISTPSGTRIRVFKNLRVCGDCHNAIKYISAIEGREIIVRDTTRFHHFRNG 285 SEKLA+AFG++STP G+ +R+ KNLR CGDCH AIK ISAIEGREI+VRD+ RFHHFRNG Sbjct: 742 SEKLAVAFGVLSTPPGSSLRIIKNLRACGDCHTAIKLISAIEGREIVVRDSNRFHHFRNG 801 Query: 284 SCSCGDYW 261 SCSCGDYW Sbjct: 802 SCSCGDYW 809 >ref|XP_007155703.1| hypothetical protein PHAVU_003G224100g [Phaseolus vulgaris] gi|561029057|gb|ESW27697.1| hypothetical protein PHAVU_003G224100g [Phaseolus vulgaris] Length = 643 Score = 124 bits (310), Expect = 2e-26 Identities = 56/68 (82%), Positives = 61/68 (89%) Frame = -3 Query: 464 SEKLAIAFGLISTPSGTRIRVFKNLRVCGDCHNAIKYISAIEGREIIVRDTTRFHHFRNG 285 SEKLAIAFGL+ PSG IRVFKNLRVCGDCH+A KYISAIEGREIIVRDT+RFHHF++G Sbjct: 576 SEKLAIAFGLLKVPSGVPIRVFKNLRVCGDCHSATKYISAIEGREIIVRDTSRFHHFKDG 635 Query: 284 SCSCGDYW 261 CSC DYW Sbjct: 636 FCSCRDYW 643 >ref|XP_004972826.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16835, mitochondrial-like [Setaria italica] Length = 508 Score = 122 bits (307), Expect = 4e-26 Identities = 55/68 (80%), Positives = 60/68 (88%) Frame = -3 Query: 464 SEKLAIAFGLISTPSGTRIRVFKNLRVCGDCHNAIKYISAIEGREIIVRDTTRFHHFRNG 285 SEKLAIAFGLIS+P G +R+FKNLRVCGDCHNA K IS IE R+II+RDTTRFHHFR G Sbjct: 441 SEKLAIAFGLISSPPGMTLRIFKNLRVCGDCHNAAKLISKIEDRKIILRDTTRFHHFRGG 500 Query: 284 SCSCGDYW 261 SCSCGDYW Sbjct: 501 SCSCGDYW 508 >ref|XP_004508953.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16835, mitochondrial-like [Cicer arietinum] Length = 637 Score = 122 bits (307), Expect = 4e-26 Identities = 56/68 (82%), Positives = 60/68 (88%) Frame = -3 Query: 464 SEKLAIAFGLISTPSGTRIRVFKNLRVCGDCHNAIKYISAIEGREIIVRDTTRFHHFRNG 285 SEKLAIAFGL+ P G IRVFKNLRVCGDCH+AIKYISAIE REIIVRDTTRFHHF++G Sbjct: 570 SEKLAIAFGLLKVPLGVPIRVFKNLRVCGDCHSAIKYISAIEEREIIVRDTTRFHHFKDG 629 Query: 284 SCSCGDYW 261 CSC DYW Sbjct: 630 LCSCSDYW 637 >ref|XP_006282848.1| hypothetical protein CARUB_v10006791mg [Capsella rubella] gi|482551553|gb|EOA15746.1| hypothetical protein CARUB_v10006791mg [Capsella rubella] Length = 662 Score = 122 bits (307), Expect = 4e-26 Identities = 53/68 (77%), Positives = 61/68 (89%) Frame = -3 Query: 464 SEKLAIAFGLISTPSGTRIRVFKNLRVCGDCHNAIKYISAIEGREIIVRDTTRFHHFRNG 285 SEKLA+AFG I P G++I+VFKNLR+CGDCH AIK+IS IE REI+VRDTTRFHHF+NG Sbjct: 595 SEKLAVAFGCIKLPQGSQIQVFKNLRICGDCHKAIKFISEIEKREIMVRDTTRFHHFKNG 654 Query: 284 SCSCGDYW 261 SCSCGDYW Sbjct: 655 SCSCGDYW 662 >ref|XP_006359230.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16835, mitochondrial-like [Solanum tuberosum] Length = 680 Score = 122 bits (306), Expect = 5e-26 Identities = 55/68 (80%), Positives = 59/68 (86%) Frame = -3 Query: 464 SEKLAIAFGLISTPSGTRIRVFKNLRVCGDCHNAIKYISAIEGREIIVRDTTRFHHFRNG 285 SEKLAIAFGL+ P G IR+FKNLRVCGDCH A K ISAIE REIIVRDTTRFHHF+NG Sbjct: 613 SEKLAIAFGLMKLPPGMPIRIFKNLRVCGDCHQATKVISAIENREIIVRDTTRFHHFKNG 672 Query: 284 SCSCGDYW 261 +CSCGDYW Sbjct: 673 TCSCGDYW 680 >ref|XP_002303374.2| hypothetical protein POPTR_0003s07960g [Populus trichocarpa] gi|550342672|gb|EEE78353.2| hypothetical protein POPTR_0003s07960g [Populus trichocarpa] Length = 589 Score = 122 bits (306), Expect = 5e-26 Identities = 56/68 (82%), Positives = 59/68 (86%) Frame = -3 Query: 464 SEKLAIAFGLISTPSGTRIRVFKNLRVCGDCHNAIKYISAIEGREIIVRDTTRFHHFRNG 285 SEKLAIA+GLI P GT IRVFKNLRVCGDCH AIKYIS IE REIIVRDTTRFHHF++G Sbjct: 522 SEKLAIAYGLIKLPPGTPIRVFKNLRVCGDCHRAIKYISQIERREIIVRDTTRFHHFKDG 581 Query: 284 SCSCGDYW 261 CSC DYW Sbjct: 582 HCSCADYW 589 >ref|NP_680717.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|357529479|sp|Q9M4P3.3|PP316_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g16835, mitochondrial; AltName: Full=Protein DYW10; Flags: Precursor gi|332658412|gb|AEE83812.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 656 Score = 122 bits (305), Expect = 7e-26 Identities = 53/68 (77%), Positives = 61/68 (89%) Frame = -3 Query: 464 SEKLAIAFGLISTPSGTRIRVFKNLRVCGDCHNAIKYISAIEGREIIVRDTTRFHHFRNG 285 SEKLA+AFG I P G++I+VFKNLR+CGDCH AIK+IS IE REIIVRDTTRFHHF++G Sbjct: 589 SEKLAVAFGCIKLPQGSQIQVFKNLRICGDCHKAIKFISEIEKREIIVRDTTRFHHFKDG 648 Query: 284 SCSCGDYW 261 SCSCGDYW Sbjct: 649 SCSCGDYW 656 >ref|XP_006578628.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16835, mitochondrial-like isoform X2 [Glycine max] gi|571451096|ref|XP_003522381.2| PREDICTED: pentatricopeptide repeat-containing protein At4g16835, mitochondrial-like isoform X1 [Glycine max] gi|571451098|ref|XP_006578629.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16835, mitochondrial-like isoform X3 [Glycine max] gi|571451100|ref|XP_006578630.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16835, mitochondrial-like isoform X4 [Glycine max] Length = 640 Score = 121 bits (304), Expect = 9e-26 Identities = 55/68 (80%), Positives = 59/68 (86%) Frame = -3 Query: 464 SEKLAIAFGLISTPSGTRIRVFKNLRVCGDCHNAIKYISAIEGREIIVRDTTRFHHFRNG 285 SEKLAIAFGL+ P G IRVFKNLRVCGDCH+A KYIS IEGREIIVRDTTRFHHF++G Sbjct: 568 SEKLAIAFGLLKVPLGVPIRVFKNLRVCGDCHSATKYISTIEGREIIVRDTTRFHHFKDG 627 Query: 284 SCSCGDYW 261 CSC DYW Sbjct: 628 FCSCRDYW 635 >ref|XP_006414294.1| hypothetical protein EUTSA_v10024626mg [Eutrema salsugineum] gi|557115464|gb|ESQ55747.1| hypothetical protein EUTSA_v10024626mg [Eutrema salsugineum] Length = 661 Score = 121 bits (304), Expect = 9e-26 Identities = 52/68 (76%), Positives = 61/68 (89%) Frame = -3 Query: 464 SEKLAIAFGLISTPSGTRIRVFKNLRVCGDCHNAIKYISAIEGREIIVRDTTRFHHFRNG 285 SEKLA+AFG + P G+RI+VFKNLR+CGDCH AIK+IS IE REI+VRDTTRFHHF++G Sbjct: 594 SEKLAVAFGCLKLPEGSRIQVFKNLRICGDCHKAIKFISEIERREIMVRDTTRFHHFKDG 653 Query: 284 SCSCGDYW 261 SCSCGDYW Sbjct: 654 SCSCGDYW 661