BLASTX nr result
ID: Akebia23_contig00055919
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00055919 (253 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_003993384.1| hypothetical protein [Streptomyces viridochr... 103 2e-20 ref|WP_009063254.1| conserved hypothetical protein, partial [Str... 103 2e-20 ref|WP_007381065.1| conserved hypothetical protein, partial [Str... 103 3e-20 ref|WP_003975503.1| hypothetical protein [Streptomyces lividans]... 103 3e-20 ref|WP_004930641.1| hypothetical protein [Streptomyces griseofla... 100 2e-19 ref|WP_005314063.1| conserved hypothetical protein, partial [Str... 100 2e-19 ref|WP_005311167.1| conserved hypothetical protein, partial [Str... 100 2e-19 ref|WP_009187877.1| hypothetical protein [Streptomyces sp. e14] ... 98 1e-18 ref|WP_004984910.1| conserved hypothetical protein, partial [Str... 96 4e-18 ref|WP_007385104.1| conserved hypothetical protein, partial [Str... 96 5e-18 ref|WP_009068222.1| conserved hypothetical protein, partial [Str... 93 4e-17 ref|WP_009714633.1| hypothetical protein, partial [Streptomyces ... 91 2e-16 ref|WP_006123540.1| conserved hypothetical protein, partial [Str... 75 1e-11 ref|WP_008748712.1| hypothetical protein, partial [Streptomyces ... 66 3e-09 gb|ADI19635.1| hypothetical protein [uncultured delta proteobact... 66 6e-09 ref|WP_006587147.1| hypothetical protein [Lactobacillus jensenii... 65 1e-08 ref|WP_008603367.1| cell wall-associated hydrolase, partial [Vei... 62 6e-08 ref|WP_008715863.1| cell wall-associated hydrolase [Veillonella ... 62 8e-08 ref|WP_008715884.1| cell wall-associated hydrolase, partial [Vei... 62 8e-08 ref|WP_009063927.1| hypothetical protein [Streptomyces sp. SPB78... 61 2e-07 >ref|WP_003993384.1| hypothetical protein [Streptomyces viridochromogenes] gi|302472168|gb|EFL35261.1| conserved hypothetical protein [Streptomyces viridochromogenes DSM 40736] Length = 66 Score = 103 bits (258), Expect = 2e-20 Identities = 49/65 (75%), Positives = 54/65 (83%), Gaps = 2/65 (3%) Frame = -3 Query: 194 LPHPAYQPSRLLGASHPQGAWKSHLEDGFPLR--QRLSVPNVANQRCSWRNNWHTRGSSI 21 LP+PAYQPSRLLGA QG +HLE GFPLR QRLS+PNVANQ C W+NNWHTRGSS+ Sbjct: 2 LPYPAYQPSRLLGALPSQGGGNTHLEAGFPLRCFQRLSLPNVANQPCPWQNNWHTRGSSV 61 Query: 20 PVLSY 6 PVLSY Sbjct: 62 PVLSY 66 >ref|WP_009063254.1| conserved hypothetical protein, partial [Streptomyces sp. SPB78] gi|302426768|gb|EFK98583.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces sp. SPB78] gi|302429649|gb|EFL01465.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces sp. SPB78] gi|302429953|gb|EFL01769.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces sp. SPB78] Length = 74 Score = 103 bits (258), Expect = 2e-20 Identities = 49/65 (75%), Positives = 54/65 (83%), Gaps = 2/65 (3%) Frame = -3 Query: 194 LPHPAYQPSRLLGASHPQGAWKSHLEDGFPLR--QRLSVPNVANQRCSWRNNWHTRGSSI 21 LP+PAYQPSRLLGA QG +HLE GFPLR QRLS+PNVANQ C W+NNWHTRGSS+ Sbjct: 10 LPYPAYQPSRLLGALPSQGGGNTHLEAGFPLRCFQRLSLPNVANQPCPWQNNWHTRGSSV 69 Query: 20 PVLSY 6 PVLSY Sbjct: 70 PVLSY 74 >ref|WP_007381065.1| conserved hypothetical protein, partial [Streptomyces sviceus] gi|297147181|gb|EFH28519.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces sviceus ATCC 29083] gi|297147699|gb|EFH28707.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces sviceus ATCC 29083] gi|297147892|gb|EFH28779.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces sviceus ATCC 29083] Length = 74 Score = 103 bits (256), Expect = 3e-20 Identities = 49/65 (75%), Positives = 53/65 (81%), Gaps = 2/65 (3%) Frame = -3 Query: 194 LPHPAYQPSRLLGASHPQGAWKSHLEDGFPLR--QRLSVPNVANQRCSWRNNWHTRGSSI 21 LP PAYQPSRLLGA PQG HLE GFPLR QRLS+PNVANQ C W++NWHTRGSS+ Sbjct: 10 LPDPAYQPSRLLGALTPQGGGSPHLEAGFPLRCFQRLSLPNVANQPCPWQDNWHTRGSSV 69 Query: 20 PVLSY 6 PVLSY Sbjct: 70 PVLSY 74 >ref|WP_003975503.1| hypothetical protein [Streptomyces lividans] gi|289701157|gb|EFD68586.1| conserved hypothetical protein [Streptomyces lividans TK24] gi|289701450|gb|EFD68879.1| conserved hypothetical protein [Streptomyces lividans TK24] gi|289702690|gb|EFD70119.1| conserved hypothetical protein [Streptomyces lividans TK24] gi|289703100|gb|EFD70529.1| conserved hypothetical protein [Streptomyces lividans TK24] Length = 66 Score = 103 bits (256), Expect = 3e-20 Identities = 49/65 (75%), Positives = 53/65 (81%), Gaps = 2/65 (3%) Frame = -3 Query: 194 LPHPAYQPSRLLGASHPQGAWKSHLEDGFPLR--QRLSVPNVANQRCSWRNNWHTRGSSI 21 LP PAYQPSRLLGA PQG HLE GFPLR QRLS+PNVANQ C W++NWHTRGSS+ Sbjct: 2 LPDPAYQPSRLLGALTPQGGGSPHLEAGFPLRCFQRLSLPNVANQPCPWQDNWHTRGSSV 61 Query: 20 PVLSY 6 PVLSY Sbjct: 62 PVLSY 66 >ref|WP_004930641.1| hypothetical protein [Streptomyces griseoflavus] gi|302477944|gb|EFL41037.1| hypothetical protein SSRG_03841 [Streptomyces griseoflavus Tu4000] Length = 66 Score = 100 bits (249), Expect = 2e-19 Identities = 48/65 (73%), Positives = 52/65 (80%), Gaps = 2/65 (3%) Frame = -3 Query: 194 LPHPAYQPSRLLGASHPQGAWKSHLEDGFPLR--QRLSVPNVANQRCSWRNNWHTRGSSI 21 LP+PAYQPSRLLGA G HLE GFPLR QRLS+PNVANQ C W+NNWHTRGSS+ Sbjct: 2 LPYPAYQPSRLLGALPSLGGGSPHLEAGFPLRCFQRLSLPNVANQPCPWQNNWHTRGSSV 61 Query: 20 PVLSY 6 PVLSY Sbjct: 62 PVLSY 66 >ref|WP_005314063.1| conserved hypothetical protein, partial [Streptomyces pristinaespiralis] gi|297151538|gb|EDY66056.2| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces pristinaespiralis ATCC 25486] gi|297152877|gb|EFH32044.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces pristinaespiralis ATCC 25486] Length = 74 Score = 100 bits (249), Expect = 2e-19 Identities = 48/65 (73%), Positives = 52/65 (80%), Gaps = 2/65 (3%) Frame = -3 Query: 194 LPHPAYQPSRLLGASHPQGAWKSHLEDGFPLR--QRLSVPNVANQRCSWRNNWHTRGSSI 21 LP+PAYQPSRLLGA QG HLE GFPLR QRLS PNVANQ C W++NWHTRGSS+ Sbjct: 10 LPYPAYQPSRLLGALPSQGGGSPHLEAGFPLRCFQRLSFPNVANQPCPWQDNWHTRGSSV 69 Query: 20 PVLSY 6 PVLSY Sbjct: 70 PVLSY 74 >ref|WP_005311167.1| conserved hypothetical protein, partial [Streptomyces pristinaespiralis] gi|297151020|gb|EDY65528.2| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces pristinaespiralis ATCC 25486] gi|297151807|gb|EFH31361.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces pristinaespiralis ATCC 25486] Length = 74 Score = 100 bits (249), Expect = 2e-19 Identities = 48/65 (73%), Positives = 52/65 (80%), Gaps = 2/65 (3%) Frame = -3 Query: 194 LPHPAYQPSRLLGASHPQGAWKSHLEDGFPLR--QRLSVPNVANQRCSWRNNWHTRGSSI 21 LP+PAYQPSRLLGA QG HLE GFPLR QRLS PNVANQ C W++NWHTRGSS+ Sbjct: 10 LPYPAYQPSRLLGALPSQGGGSPHLEAGFPLRCFQRLSFPNVANQPCPWQDNWHTRGSSV 69 Query: 20 PVLSY 6 PVLSY Sbjct: 70 PVLSY 74 >ref|WP_009187877.1| hypothetical protein [Streptomyces sp. e14] gi|292830510|gb|EFF88860.1| hypothetical protein SSTG_04730 [Streptomyces sp. e14] gi|292831950|gb|EFF90299.1| hypothetical protein SSTG_00617 [Streptomyces sp. e14] gi|292833022|gb|EFF91371.1| hypothetical protein SSTG_01690 [Streptomyces sp. e14] gi|292833480|gb|EFF91829.1| hypothetical protein SSTG_02148 [Streptomyces sp. e14] gi|292834018|gb|EFF92367.1| hypothetical protein SSTG_02686 [Streptomyces sp. e14] Length = 66 Score = 98.2 bits (243), Expect = 1e-18 Identities = 48/65 (73%), Positives = 51/65 (78%), Gaps = 2/65 (3%) Frame = -3 Query: 194 LPHPAYQPSRLLGASHPQGAWKSHLEDGFPLR--QRLSVPNVANQRCSWRNNWHTRGSSI 21 LP PAYQPSRLLGA Q HLE GFPLR QRLS+PNVANQ C W+NNWHTRGSS+ Sbjct: 2 LPDPAYQPSRLLGALPHQVGGSPHLEAGFPLRCFQRLSLPNVANQPCPWQNNWHTRGSSV 61 Query: 20 PVLSY 6 PVLSY Sbjct: 62 PVLSY 66 >ref|WP_004984910.1| conserved hypothetical protein, partial [Streptomyces ghanaensis] gi|291340927|gb|EFE67883.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces ghanaensis ATCC 14672] gi|291341606|gb|EFE68562.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces ghanaensis ATCC 14672] gi|291342163|gb|EFE69119.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces ghanaensis ATCC 14672] gi|291343781|gb|EFE70737.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces ghanaensis ATCC 14672] Length = 74 Score = 96.3 bits (238), Expect = 4e-18 Identities = 47/65 (72%), Positives = 51/65 (78%), Gaps = 2/65 (3%) Frame = -3 Query: 194 LPHPAYQPSRLLGASHPQGAWKSHLEDGFPLR--QRLSVPNVANQRCSWRNNWHTRGSSI 21 LP PAYQPSRLLGA Q HLE GFPLR QRLS+PNVANQ C W++NWHTRGSS+ Sbjct: 10 LPDPAYQPSRLLGALPHQVGGSPHLEAGFPLRCFQRLSLPNVANQPCPWQDNWHTRGSSV 69 Query: 20 PVLSY 6 PVLSY Sbjct: 70 PVLSY 74 >ref|WP_007385104.1| conserved hypothetical protein, partial [Streptomyces sviceus] gi|297148196|gb|EFH28880.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces sviceus ATCC 29083] Length = 70 Score = 95.9 bits (237), Expect = 5e-18 Identities = 45/61 (73%), Positives = 49/61 (80%), Gaps = 2/61 (3%) Frame = -3 Query: 194 LPHPAYQPSRLLGASHPQGAWKSHLEDGFPLR--QRLSVPNVANQRCSWRNNWHTRGSSI 21 LP PAYQPSRLLGA PQG HLE GFPLR QRLS+PNVANQ C W++NWHTRGSS+ Sbjct: 10 LPDPAYQPSRLLGALTPQGGGSPHLEAGFPLRCFQRLSLPNVANQPCPWQDNWHTRGSSV 69 Query: 20 P 18 P Sbjct: 70 P 70 >ref|WP_009068222.1| conserved hypothetical protein, partial [Streptomyces sp. SPB78] gi|302430314|gb|EFL02130.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces sp. SPB78] Length = 68 Score = 92.8 bits (229), Expect = 4e-17 Identities = 44/59 (74%), Positives = 48/59 (81%), Gaps = 2/59 (3%) Frame = -3 Query: 194 LPHPAYQPSRLLGASHPQGAWKSHLEDGFPLR--QRLSVPNVANQRCSWRNNWHTRGSS 24 LP+PAYQPSRLLGA QG +HLE GFPLR QRLS+PNVANQ C W+NNWHTRGSS Sbjct: 10 LPYPAYQPSRLLGALPSQGGGNTHLEAGFPLRCFQRLSLPNVANQPCPWQNNWHTRGSS 68 >ref|WP_009714633.1| hypothetical protein, partial [Streptomyces himastatinicus] gi|302459719|gb|EFL22812.1| LOW QUALITY PROTEIN: hypothetical protein SSOG_02526 [Streptomyces himastatinicus ATCC 53653] Length = 74 Score = 90.9 bits (224), Expect = 2e-16 Identities = 45/65 (69%), Positives = 50/65 (76%), Gaps = 2/65 (3%) Frame = -3 Query: 194 LPHPAYQPSRLLGASHPQGAWKSHLEDGFPLR--QRLSVPNVANQRCSWRNNWHTRGSSI 21 LP+ AYQPSRLLGA Q HLE GFPLR QRLS+PNVANQ C W++NWHT GSS+ Sbjct: 10 LPYLAYQPSRLLGALTHQVGGSPHLEAGFPLRCFQRLSLPNVANQPCPWQDNWHTGGSSV 69 Query: 20 PVLSY 6 PVLSY Sbjct: 70 PVLSY 74 >ref|WP_006123540.1| conserved hypothetical protein, partial [Streptomyces filamentosus] gi|291346639|gb|EFE73543.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces roseosporus NRRL 15998] gi|291348565|gb|EFE75469.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces roseosporus NRRL 15998] gi|291348853|gb|EFE75757.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces roseosporus NRRL 15998] Length = 50 Score = 74.7 bits (182), Expect = 1e-11 Identities = 34/48 (70%), Positives = 39/48 (81%), Gaps = 2/48 (4%) Frame = -3 Query: 143 QGAWKSHLEDGFPLR--QRLSVPNVANQRCSWRNNWHTRGSSIPVLSY 6 +G +HLE GFPLR QRLS PNVANQ C W++NWHTRGSS+PVLSY Sbjct: 3 KGGGNTHLEAGFPLRCFQRLSFPNVANQPCPWQDNWHTRGSSVPVLSY 50 >ref|WP_008748712.1| hypothetical protein, partial [Streptomyces sp. SPB74] gi|295827601|gb|EDY46972.2| hypothetical protein SSBG_04935 [Streptomyces sp. SPB74] Length = 77 Score = 66.2 bits (160), Expect(2) = 3e-09 Identities = 30/42 (71%), Positives = 34/42 (80%), Gaps = 2/42 (4%) Frame = -3 Query: 143 QGAWKSHLEDGFPLR--QRLSVPNVANQRCSWRNNWHTRGSS 24 +G +HLE GFPLR QRLS+PNVANQ C W+NNWHTRGSS Sbjct: 36 KGGGNTHLEAGFPLRCFQRLSLPNVANQPCPWQNNWHTRGSS 77 Score = 20.8 bits (42), Expect(2) = 3e-09 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 246 SSLRLISTGQLHGS 205 +S R ISTGQLH S Sbjct: 3 TSPRPISTGQLHPS 16 >gb|ADI19635.1| hypothetical protein [uncultured delta proteobacterium HF0770_45N15] Length = 155 Score = 65.9 bits (159), Expect = 6e-09 Identities = 38/68 (55%), Positives = 44/68 (64%), Gaps = 3/68 (4%) Frame = -1 Query: 199 PRFHIRPINPVVY-WEPLTLKGHGSLILKTASRLD--SGYPFRT*LISGAPGGTTGTPEV 29 PRFH+RPI VV+ W + + +L SRLD SG PFRT L GA G TTG+PEV Sbjct: 75 PRFHLRPIKQVVFLWPSGSAEALREEVLGGGSRLDAFSGSPFRTQLPGGAAGATTGSPEV 134 Query: 28 RPSRSSRT 5 RP RSSRT Sbjct: 135 RPPRSSRT 142 >ref|WP_006587147.1| hypothetical protein [Lactobacillus jensenii] gi|260560634|gb|EEX26613.1| hypothetical protein HMPREF0527_01622 [Lactobacillus jensenii SJ-7A-US] gi|297149549|gb|EFH29847.1| hypothetical protein HMPREF0526_11450 [Lactobacillus jensenii JV-V16] Length = 49 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/44 (70%), Positives = 34/44 (77%), Gaps = 2/44 (4%) Frame = -3 Query: 131 KSHLEDGFPLR--QRLSVPNVANQRCSWRNNWHTRGSSIPVLSY 6 KSHLE GF LR QRLS P +A QRC W+NNW+T G SIPVLSY Sbjct: 6 KSHLEGGFALRCFQRLSRPYIATQRCPWQNNWYTSGMSIPVLSY 49 >ref|WP_008603367.1| cell wall-associated hydrolase, partial [Veillonella sp. 6_1_27] gi|294456247|gb|EFG24611.1| LOW QUALITY PROTEIN: hypothetical protein HMPREF0874_01772, partial [Veillonella sp. 6_1_27] Length = 83 Score = 62.4 bits (150), Expect = 6e-08 Identities = 41/85 (48%), Positives = 46/85 (54%), Gaps = 10/85 (11%) Frame = -3 Query: 230 LVPVSSTGR*SPLPHPAYQPSRLLGASHPQGAW--------KSHLEDGFPLR--QRLSVP 81 LVPVSS PH + P G S W K HL+ GF LR QRLSVP Sbjct: 9 LVPVSSN------PHGSSTP----GLSTMSSTWDLTSLCYEKPHLKAGFTLRCFQRLSVP 58 Query: 80 NVANQRCSWRNNWHTRGSSIPVLSY 6 NVA Q W++NW+T GSS PVLSY Sbjct: 59 NVATQLYPWQDNWYTSGSSTPVLSY 83 >ref|WP_008715863.1| cell wall-associated hydrolase [Veillonella sp. 3_1_44] gi|294453908|gb|EFG22289.1| hypothetical protein HMPREF0873_01868 [Veillonella sp. 3_1_44] Length = 94 Score = 62.0 bits (149), Expect = 8e-08 Identities = 41/85 (48%), Positives = 46/85 (54%), Gaps = 10/85 (11%) Frame = -3 Query: 230 LVPVSSTGR*SPLPHPAYQPSRLLGASHPQGAW--------KSHLEDGFPLR--QRLSVP 81 LVPVSS PH + P G S W K HL+ GF LR QRLSVP Sbjct: 20 LVPVSSK------PHGSSTP----GLSTMSSTWDLTSLRYEKPHLKAGFTLRCFQRLSVP 69 Query: 80 NVANQRCSWRNNWHTRGSSIPVLSY 6 NVA Q W++NW+T GSS PVLSY Sbjct: 70 NVATQLYPWQDNWYTSGSSTPVLSY 94 >ref|WP_008715884.1| cell wall-associated hydrolase, partial [Veillonella sp. 3_1_44] gi|294453902|gb|EFG22286.1| LOW QUALITY PROTEIN: hypothetical protein HMPREF0873_01871, partial [Veillonella sp. 3_1_44] Length = 83 Score = 62.0 bits (149), Expect = 8e-08 Identities = 41/85 (48%), Positives = 46/85 (54%), Gaps = 10/85 (11%) Frame = -3 Query: 230 LVPVSSTGR*SPLPHPAYQPSRLLGASHPQGAW--------KSHLEDGFPLR--QRLSVP 81 LVPVSS PH + P G S W K HL+ GF LR QRLSVP Sbjct: 9 LVPVSSK------PHGSSTP----GLSTMSSTWDLTSFCYEKPHLKAGFTLRCFQRLSVP 58 Query: 80 NVANQRCSWRNNWHTRGSSIPVLSY 6 NVA Q W++NW+T GSS PVLSY Sbjct: 59 NVATQLYPWQDNWYTSGSSTPVLSY 83 >ref|WP_009063927.1| hypothetical protein [Streptomyces sp. SPB78] gi|302427150|gb|EFK98965.1| conserved hypothetical protein [Streptomyces sp. SPB78] Length = 79 Score = 60.8 bits (146), Expect = 2e-07 Identities = 35/58 (60%), Positives = 38/58 (65%), Gaps = 9/58 (15%) Frame = -1 Query: 223 RSAPRVVSPR-------FHIRPINPVVYWEPLTLKGHGSLILKTASRLD--SGYPFRT 77 R++PR +S FHIRPINPVVYWEP LK G LI K ASRLD SGYP RT Sbjct: 22 RTSPRPISTGQLHPLQGFHIRPINPVVYWEPYPLKEVGILISKQASRLDAFSGYPSRT 79