BLASTX nr result
ID: Akebia23_contig00054554
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00054554 (314 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMT26544.1| Fidgetin-like protein 1 [Aegilops tauschii] 58 1e-06 gb|EMT24896.1| Putative serine/threonine-protein kinase GCN2 [Ae... 55 8e-06 >gb|EMT26544.1| Fidgetin-like protein 1 [Aegilops tauschii] Length = 693 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/55 (52%), Positives = 41/55 (74%), Gaps = 2/55 (3%) Frame = -1 Query: 230 VSEAKHRT*DNL--RLDAKVGEKDVYKLAKIRERKIRYVNNIRCIKGKDDRMLVR 72 VSEA+ R ++L RLD K GE+D+YK+ KI+ERK R VN ++CIK D++LV+ Sbjct: 614 VSEARARAYEDLYRRLDTKEGERDIYKMTKIQERKTRDVNQVKCIKDGADQLLVK 668 >gb|EMT24896.1| Putative serine/threonine-protein kinase GCN2 [Aegilops tauschii] Length = 783 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/41 (58%), Positives = 33/41 (80%) Frame = -1 Query: 194 RLDAKVGEKDVYKLAKIRERKIRYVNNIRCIKGKDDRMLVR 72 RL+ K GE+D+YK+AKIR+RK R VN ++CIK DR+LV+ Sbjct: 704 RLNTKEGERDIYKMAKIRQRKARGVNQVKCIKNGADRLLVK 744